Protein Family IF06074
Metagenome
Isolate
170
Members
41
Samples
165
Scaffolds
257.22
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_056613|Ga0466713_056613_239_1099
- Length
- 265 aa
- Sequence
- MAQKGAAFYSGGVEDTRGERNIGLLLAYDGTDFSGWARQEGVRTVQGEIEAALERLHQRPVALTGSGRTDAGVHAAGQRANFRTGLRMDAARFVPALNGFLPRDIRVLAAWDAAPDFHSRFDARARTYRYHLVCGRPALPWELRYAWSLRRRPSLEALNNCARLLSGELDCTAFAVPGDKSLSRSRCFYGASFFVERDTLVFEITANAFLWKMARSITGTLLRFEEAGLPPEAFRELLASGDRTRAGPTAPPQGLFLWHIAYYKE
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.0%
Termitidae
30.0%
Unclassified
15.0%
Rhinotermitidae
10.0%
Termopsidae
7.5%
Blaberidae
2.5%
Taxonomy
Archaea
0
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 11 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 12 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 13 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 14 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 35 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 36 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 37 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_062118 | 3300042612 | Bacteria | 1394 |
| 2 | Ga0466716_251399 | 3300042605 | Bacteria | 22558 |
| 3 | Ga0466719_392930 | 3300042606 | Bacteria | 3745 |
| 4 | Ga0466690_126742 | 3300042590 | Bacteria | 4679 |
| 5 | Ga0466692_168505 | 3300042591 | Bacteria | 1025 |
| 6 | Ga0466691_067030 | 3300042593 | Bacteria | 10833 |
| 7 | Ga0123353_11340464 | 3300010167 | Bacteria | 925 |
| 8 | Ga0466715_077221 | 3300042616 | Bacteria | 18621 |
| 9 | Ga0466715_207216 | 3300042616 | Bacteria | 5741 |
| 10 | Ga0466715_243549 | 3300042616 | Bacteria | 13882 |
| 11 | Ga0466715_619748 | 3300042616 | Bacteria | 2461 |
| 12 | Ga0466723_292232 | 3300042618 | Bacteria | 87547 |
| 13 | Ga0466704_307357 | 3300042643 | Bacteria | 6010 |
| 14 | Ga0466704_419139 | 3300042643 | Bacteria | 10889 |
| 15 | Ga0466709_076915 | 3300042648 | Bacteria | 29343 |
| 16 | Ga0466733_179267 | 3300042659 | Bacteria | 30961 |
| 17 | Ga0466707_398983 | 3300042601 | Bacteria | 1239 |
| 18 | Ga0466719_063850 | 3300042606 | Bacteria | 14644 |
| 19 | Ga0466720_111891 | 3300042607 | Bacteria | 23574 |
| 20 | Ga0466722_017904 | 3300042609 | Bacteria | 9151 |
| 21 | Ga0466692_070782 | 3300042591 | Bacteria | 9390 |
| 22 | Ga0466691_126102 | 3300042593 | Bacteria | 7955 |
| 23 | Ga0466691_216913 | 3300042593 | Bacteria | 11912 |
| 24 | Ga0466696_459168 | 3300042596 | Bacteria | 2439 |
| 25 | Ga0466715_146030 | 3300042616 | Bacteria | 18663 |
| 26 | Ga0466715_407839 | 3300042616 | Unclassified | 1502 |
| 27 | Ga0466715_549137 | 3300042616 | Bacteria | 3704 |
| 28 | Ga0466715_553227 | 3300042616 | Bacteria | 1282 |
| 29 | Ga0466715_574045 | 3300042616 | Bacteria | 2542 |
| 30 | Ga0466723_052167 | 3300042618 | Bacteria | 6533 |
| 31 | Ga0466723_362929 | 3300042618 | Bacteria | 13565 |
| 32 | Ga0466728_207119 | 3300042620 | Bacteria | 2803 |
| 33 | Ga0466735_154587 | 3300042624 | Bacteria | 1285 |
| 34 | Ga0466703_084316 | 3300042636 | Bacteria | 5267 |
| 35 | Ga0466703_147752 | 3300042636 | Bacteria | 42366 |
| 36 | Ga0466709_144231 | 3300042648 | Bacteria | 14996 |
| 37 | Ga0466708_097548 | 3300042652 | Bacteria | 2199 |
| 38 | Ga0466708_126655 | 3300042652 | Bacteria | 2336 |
| 39 | Ga0466708_334123 | 3300042652 | Bacteria | 55617 |
| 40 | Ga0466708_387580 | 3300042652 | Bacteria | 1874 |
| 41 | Ga0466727_039945 | 3300042655 | Bacteria | 10451 |
| 42 | JGI24698J34947_10019045 | 3300002449 | Bacteria | 3706 |
| 43 | Ga0072941_1001887 | 3300005201 | Bacteria | 25060 |
| 44 | Ga0072941_1055446 | 3300005201 | Bacteria | 11027 |
| 45 | Ga0466705_136352 | 3300042612 | Bacteria | 10984 |
| 46 | Ga0466707_344354 | 3300042601 | Bacteria | 15444 |
| 47 | Ga0466720_164064 | 3300042607 | Bacteria | 2470 |
| 48 | Ga0466722_248094 | 3300042609 | Bacteria | 4921 |
| 49 | Ga0466696_383652 | 3300042596 | Bacteria | 3154 |
| 50 | Ga0466699_010223 | 3300042597 | Bacteria | 33041 |
| 51 | Ga0466711_025590 | 3300042615 | Bacteria | 41697 |
| 52 | Ga0466711_034591 | 3300042615 | Bacteria | 4407 |
| 53 | Ga0466715_062933 | 3300042616 | Bacteria | 5348 |
| 54 | Ga0466715_632589 | 3300042616 | Bacteria | 5333 |
| 55 | Ga0466723_118093 | 3300042618 | Bacteria | 2857 |
| 56 | Ga0466723_207387 | 3300042618 | Bacteria | 8293 |
| 57 | Ga0466723_356718 | 3300042618 | Bacteria | 8341 |
| 58 | Ga0466728_051050 | 3300042620 | Bacteria | 4496 |
| 59 | Ga0466728_175439 | 3300042620 | Bacteria | 13012 |
| 60 | Ga0466728_320606 | 3300042620 | Bacteria | 11540 |
| 61 | Ga0466731_047354 | 3300042622 | Bacteria | 5956 |
| 62 | Ga0466703_239750 | 3300042636 | Unclassified | 11228 |
| 63 | Ga0466708_071970 | 3300042652 | Bacteria | 22670 |
| 64 | Ga0466727_296777 | 3300042655 | Bacteria | 3410 |
| 65 | Ga0466705_120929 | 3300042612 | Bacteria | 19426 |
| 66 | Ga0466707_164282 | 3300042601 | Bacteria | 1166 |
| 67 | Ga0466707_175813 | 3300042601 | Bacteria | 2412 |
| 68 | Ga0466719_111901 | 3300042606 | Bacteria | 1855 |
| 69 | Ga0466690_070062 | 3300042590 | Bacteria | 4258 |
| 70 | Ga0466693_034119 | 3300042592 | Bacteria | 1462 |
| 71 | Ga0466691_049619 | 3300042593 | Bacteria | 15579 |
| 72 | Ga0466691_173004 | 3300042593 | Bacteria | 6791 |
| 73 | Ga0466715_293742 | 3300042616 | Bacteria | 13394 |
| 74 | Ga0466726_300858 | 3300042619 | Bacteria | 1220 |
| 75 | Ga0466728_159186 | 3300042620 | Bacteria | 13505 |
| 76 | Ga0466729_021336 | 3300042621 | Bacteria | 6687 |
| 77 | Ga0466729_040093 | 3300042621 | Bacteria | 1365 |
| 78 | Ga0466703_015771 | 3300042636 | Bacteria | 29338 |
| 79 | Ga0466704_165993 | 3300042643 | Bacteria | 7747 |
| 80 | Ga0466709_041520 | 3300042648 | Bacteria | 21676 |
| 81 | Ga0466709_091996 | 3300042648 | Bacteria | 1226 |
| 82 | Ga0466709_279801 | 3300042648 | Bacteria | 4098 |
| 83 | Ga0466727_249424 | 3300042655 | Bacteria | 2910 |
| 84 | JGI24698J34947_10076459 | 3300002449 | Bacteria | 1587 |
| 85 | Ga0466716_159325 | 3300042605 | Bacteria | 11511 |
| 86 | Ga0466719_373497 | 3300042606 | Bacteria | 1733 |
| 87 | Ga0466719_389225 | 3300042606 | Bacteria | 11545 |
| 88 | Ga0466690_277729 | 3300042590 | Bacteria | 7189 |
| 89 | Ga0466691_180846 | 3300042593 | Unclassified | 3095 |
| 90 | Ga0466705_488971 | 3300042612 | Bacteria | 7617 |
| 91 | Ga0466712_099229 | 3300042614 | Bacteria | 9523 |
| 92 | Ga0466712_199703 | 3300042614 | Bacteria | 1761 |
| 93 | Ga0466711_130319 | 3300042615 | Bacteria | 17511 |
| 94 | Ga0466711_297363 | 3300042615 | Bacteria | 10334 |
| 95 | Ga0466711_331233 | 3300042615 | Unclassified | 3076 |
| 96 | Ga0466723_172579 | 3300042618 | Bacteria | 12734 |
| 97 | Ga0466728_236688 | 3300042620 | Bacteria | 8055 |
| 98 | Ga0466735_014374 | 3300042624 | Bacteria | 1012 |
| 99 | Ga0466704_046384 | 3300042643 | Bacteria | 22946 |
| 100 | JGI24702J35022_10034006 | 3300002462 | Bacteria | 2726 |
| 101 | Ga0072941_1001763 | 3300005201 | Bacteria | 10967 |
| 102 | Ga0466705_011421 | 3300042612 | Bacteria | 6664 |
| 103 | Ga0466705_021803 | 3300042612 | Bacteria | 3419 |
| 104 | Ga0466705_227498 | 3300042612 | Bacteria | 4636 |
| 105 | Ga0466707_125967 | 3300042601 | Bacteria | 2189 |
| 106 | Ga0466707_160903 | 3300042601 | Bacteria | 1932 |
| 107 | Ga0466707_397127 | 3300042601 | Bacteria | 3741 |
| 108 | Ga0466713_056613 | 3300042602 | Bacteria | 1142 |
| 109 | Ga0466719_042716 | 3300042606 | Bacteria | 1318 |
| 110 | Ga0466719_364035 | 3300042606 | Bacteria | 1551 |
| 111 | Ga0466690_006302 | 3300042590 | Bacteria | 1488 |
| 112 | Ga0466691_173471 | 3300042593 | Bacteria | 2492 |
| 113 | Ga0466696_368694 | 3300042596 | Bacteria | 2257 |
| 114 | Ga0466715_167652 | 3300042616 | Bacteria | 3462 |
| 115 | Ga0466715_386742 | 3300042616 | Bacteria | 3922 |
| 116 | Ga0466726_209663 | 3300042619 | Bacteria | 13562 |
| 117 | Ga0466726_457625 | 3300042619 | Bacteria | 3773 |
| 118 | Ga0466704_100452 | 3300042643 | Bacteria | 14897 |
| 119 | Ga0466709_384771 | 3300042648 | Bacteria | 6681 |
| 120 | Ga0466708_108592 | 3300042652 | Bacteria | 6961 |
| 121 | Ga0072940_1003507 | 3300005200 | Bacteria | 1379 |
| 122 | Ga0466705_066851 | 3300042612 | Bacteria | 8061 |
| 123 | Ga0466705_192192 | 3300042612 | Bacteria | 15227 |
| 124 | Ga0466716_113692 | 3300042605 | Unclassified | 4859 |
| 125 | Ga0466716_521321 | 3300042605 | Bacteria | 1802 |
| 126 | Ga0466719_038984 | 3300042606 | Bacteria | 1819 |
| 127 | Ga0466719_212219 | 3300042606 | Bacteria | 2101 |
| 128 | Ga0466719_399867 | 3300042606 | Bacteria | 4754 |
| 129 | Ga0466719_448712 | 3300042606 | Bacteria | 1395 |
| 130 | Ga0456237_0001070 | 3300041968 | Bacteria | 4331 |
| 131 | Ga0466694_092988 | 3300042594 | Bacteria | 4980 |
| 132 | Ga0466705_437384 | 3300042612 | Bacteria | 18300 |
| 133 | Ga0466711_007766 | 3300042615 | Bacteria | 7509 |
| 134 | Ga0466715_427848 | 3300042616 | Bacteria | 1965 |
| 135 | Ga0466715_460234 | 3300042616 | Bacteria | 6195 |
| 136 | Ga0466715_560055 | 3300042616 | Bacteria | 4904 |
| 137 | Ga0466723_161161 | 3300042618 | Bacteria | 2638 |
| 138 | Ga0466726_019347 | 3300042619 | Bacteria | 5931 |
| 139 | Ga0466726_075804 | 3300042619 | Bacteria | 1030 |
| 140 | Ga0466728_085570 | 3300042620 | Bacteria | 4317 |
| 141 | Ga0466728_090991 | 3300042620 | Bacteria | 26012 |
| 142 | Ga0466735_157939 | 3300042624 | Bacteria | 4594 |
| 143 | Ga0466703_177474 | 3300042636 | Bacteria | 18778 |
| 144 | Ga0466703_278673 | 3300042636 | Bacteria | 1102 |
| 145 | Ga0466703_280653 | 3300042636 | Bacteria | 4597 |
| 146 | Ga0466709_384223 | 3300042648 | Bacteria | 15086 |
| 147 | Ga0466708_073933 | 3300042652 | Bacteria | 2210 |
| 148 | Ga0466701_083511 | 3300042598 | Bacteria | 1055 |
| 149 | Ga0466716_086403 | 3300042605 | Bacteria | 5507 |
| 150 | Ga0466719_311456 | 3300042606 | Bacteria | 7737 |
| 151 | Ga0466719_374092 | 3300042606 | Bacteria | 1181 |
| 152 | Ga0466722_036744 | 3300042609 | Bacteria | 1557 |
| 153 | Ga0466692_041598 | 3300042591 | Bacteria | 6571 |
| 154 | Ga0466692_169674 | 3300042591 | Bacteria | 1888 |
| 155 | Ga0466692_196384 | 3300042591 | Bacteria | 1163 |
| 156 | Ga0466691_187278 | 3300042593 | Bacteria | 9907 |
| 157 | Ga0466711_311224 | 3300042615 | Bacteria | 1473 |
| 158 | Ga0466723_063965 | 3300042618 | Bacteria | 1658 |
| 159 | Ga0466723_332810 | 3300042618 | Bacteria | 10274 |
| 160 | Ga0466726_391124 | 3300042619 | Bacteria | 8681 |
| 161 | Ga0466728_100718 | 3300042620 | Bacteria | 7645 |
| 162 | Ga0466728_188647 | 3300042620 | Bacteria | 7600 |
| 163 | Ga0466703_254861 | 3300042636 | Bacteria | 6146 |
| 164 | Ga0466703_372163 | 3300042636 | Bacteria | 1448 |
| 165 | Ga0466727_344783 | 3300042655 | Bacteria | 1138 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01416 | PseudoU_synth_1 | tRNA pseudouridine synthase | 27 | 122 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.