Protein Family IF06062
Metagenome
Isolate
128
Members
55
Samples
107
Scaffolds
260.29
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_044186|Ga0466713_044186_5726_6637
- Length
- 303 aa
- Sequence
- MGIYGNKIVSRETFFLLQQGLFHVKQWGMIEITRNRHHKWVFSWEEEVGKAIAIFNQKGGVGKTTTNINLAACLALKGKKVLIMDIDPQGNTTSGVGVSKSGLEYTMYDILIDDSVNPADAICDTSIPGLKLLPASVELAGAEIELVQLEGREHRLKNAVAKIKDDFDFLFIDCPPSLGLLSINSLTAVESVLIPIQCEYYALEGVSQLMSTIELVRQNLNPNLEIEGVILSMFDGRTNLSIQVVEEVKKYFRDKVYTTVIPRNVRLAEAPSYGMPIAEYDPKSKGAEAYMEFAEEFLEGENG
Sample Types
Isolate
16.4%
Metagenome
83.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.6%
Unclassified
18.5%
Kalotermitidae
18.5%
Blattidae
16.7%
Termopsidae
5.6%
Stratiomyidae
3.7%
Rhinotermitidae
3.7%
Scarabaeidae
1.9%
Passalidae
1.9%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 2 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 3 | 2820092068 | Unclassified Proteobacteria Lab288P3bin38 | Isolate | Unclassified |
| 4 | 2820711732 | Unclassified Firmicutes Co191P1bin26 | Isolate | Unclassified |
| 5 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 6 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 7 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 8 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 9 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 10 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 11 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 12 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 13 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 14 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 17 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 18 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 19 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 22 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 27 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 37 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 38 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 39 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 43 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 46 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 47 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 48 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 53 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 54 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 55 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_089647 | 3300042611 | Unclassified | 3687 |
| 2 | Ga0123357_10303649 | 3300009784 | Bacteria | 1607 |
| 3 | Ga0123353_10043573 | 3300010167 | Bacteria | 7111 |
| 4 | Ga0123354_10456144 | 3300010882 | Bacteria | 1031 |
| 5 | Ga0466694_135668 | 3300042594 | Bacteria | 3537 |
| 6 | Ga0466713_044186 | 3300042602 | Bacteria | 91853 |
| 7 | Ga0466719_146977 | 3300042606 | Bacteria | 1805 |
| 8 | Ga0466715_225213 | 3300042616 | Bacteria | 12111 |
| 9 | Ga0466715_540336 | 3300042616 | Bacteria | 3672 |
| 10 | Ga0466726_087401 | 3300042619 | Bacteria | 1735 |
| 11 | Ga0466735_206379 | 3300042624 | Bacteria | 1478 |
| 12 | Ga0466703_178478 | 3300042636 | Bacteria | 3637 |
| 13 | Ga0466708_281112 | 3300042652 | Bacteria | 8488 |
| 14 | Ga0466733_107100 | 3300042659 | Bacteria | 1105 |
| 15 | Ga0123354_10039262 | 3300010882 | Bacteria | 7341 |
| 16 | Ga0466696_097202 | 3300042596 | Bacteria | 12001 |
| 17 | Ga0466707_120029 | 3300042601 | Bacteria | 4151 |
| 18 | Ga0466707_242534 | 3300042601 | Unclassified | 2374 |
| 19 | Ga0466714_054536 | 3300042603 | Bacteria | 4681 |
| 20 | Ga0466719_025235 | 3300042606 | Bacteria | 2010 |
| 21 | Ga0466722_073801 | 3300042609 | Bacteria | 3001 |
| 22 | Ga0466705_507658 | 3300042612 | Bacteria | 1910 |
| 23 | Ga0466697_126487 | 3300042611 | Bacteria | 1205 |
| 24 | Ga0123357_10065215 | 3300009784 | Bacteria | 4863 |
| 25 | Ga0123356_10277019 | 3300010049 | Bacteria | 1770 |
| 26 | Ga0123356_10547871 | 3300010049 | Unclassified | 1317 |
| 27 | Ga0123353_10436705 | 3300010167 | Bacteria | 1933 |
| 28 | Ga0466707_296781 | 3300042601 | Bacteria | 32330 |
| 29 | Ga0466719_436148 | 3300042606 | Bacteria | 3588 |
| 30 | Ga0466711_423856 | 3300042615 | Bacteria | 29135 |
| 31 | Ga0466726_316888 | 3300042619 | Bacteria | 11804 |
| 32 | Ga0466729_059561 | 3300042621 | Bacteria | 9513 |
| 33 | 2227483549 | 2225789004 | Bacteria | 4341 |
| 34 | JGI24702J35022_10032204 | 3300002462 | Bacteria | 2808 |
| 35 | Ga0105524_107160 | 3300007733 | Bacteria | 2214 |
| 36 | Ga0466703_370562 | 3300042636 | Bacteria | 8785 |
| 37 | Ga0466704_302742 | 3300042643 | Bacteria | 2126 |
| 38 | Ga0466709_298145 | 3300042648 | Bacteria | 6288 |
| 39 | Ga0123357_10015878 | 3300009784 | Bacteria | 9883 |
| 40 | Ga0123353_10004052 | 3300010167 | Bacteria | 18773 |
| 41 | Ga0123353_10009409 | 3300010167 | Bacteria | 13487 |
| 42 | Ga0123353_10125818 | 3300010167 | Bacteria | 4119 |
| 43 | Ga0123353_10204883 | 3300010167 | Bacteria | 3100 |
| 44 | Ga0123353_10423860 | 3300010167 | Bacteria | 1971 |
| 45 | Ga0123353_10578336 | 3300010167 | Bacteria | 1612 |
| 46 | Ga0123353_10644593 | 3300010167 | Bacteria | 1501 |
| 47 | Ga0466707_221265 | 3300042601 | Bacteria | 36581 |
| 48 | Ga0466719_118226 | 3300042606 | Unclassified | 2722 |
| 49 | Ga0466711_337858 | 3300042615 | Bacteria | 4123 |
| 50 | Ga0466726_056254 | 3300042619 | Bacteria | 1560 |
| 51 | JGI24705J35276_12233888 | 3300002504 | Unclassified | 5124 |
| 52 | Ga0466704_092011 | 3300042643 | Unclassified | 36798 |
| 53 | Ga0466704_115381 | 3300042643 | Unclassified | 23116 |
| 54 | Ga0466704_413812 | 3300042643 | Unclassified | 2606 |
| 55 | Ga0466697_221249 | 3300042611 | Bacteria | 1947 |
| 56 | Ga0466705_129192 | 3300042612 | Bacteria | 1963 |
| 57 | Ga0123355_10001570 | 3300009826 | Bacteria | 31898 |
| 58 | Ga0123355_10122960 | 3300009826 | Bacteria | 4021 |
| 59 | Ga0123356_10121060 | 3300010049 | Bacteria | 2545 |
| 60 | Ga0466657_210667 | 3300042582 | Bacteria | 1601 |
| 61 | Ga0466696_068461 | 3300042596 | Bacteria | 1916 |
| 62 | Ga0466696_095782 | 3300042596 | Bacteria | 5223 |
| 63 | Ga0466696_223856 | 3300042596 | Bacteria | 3032 |
| 64 | Ga0466707_298358 | 3300042601 | Unclassified | 7609 |
| 65 | Ga0466707_362526 | 3300042601 | Unclassified | 5601 |
| 66 | Ga0466719_019371 | 3300042606 | Unclassified | 5641 |
| 67 | Ga0466698_183149 | 3300042610 | Bacteria | 5361 |
| 68 | Ga0466726_474651 | 3300042619 | Bacteria | 1295 |
| 69 | Ga0068302_10243046 | 3300005071 | Bacteria | 4938 |
| 70 | Ga0068305_10287580 | 3300005083 | Bacteria | 2304 |
| 71 | Ga0466734_002425 | 3300042623 | Unclassified | 1791 |
| 72 | Ga0466703_017272 | 3300042636 | Bacteria | 4378 |
| 73 | Ga0466704_574391 | 3300042643 | Bacteria | 1728 |
| 74 | Ga0123355_10113446 | 3300009826 | Bacteria | 4227 |
| 75 | Ga0123356_10021899 | 3300010049 | Bacteria | 6035 |
| 76 | Ga0123353_10006938 | 3300010167 | Unclassified | 15226 |
| 77 | Ga0123354_10000347 | 3300010882 | Bacteria | 43465 |
| 78 | Ga0123354_10087740 | 3300010882 | Unclassified | 4334 |
| 79 | Ga0466707_174734 | 3300042601 | Bacteria | 5970 |
| 80 | Ga0466707_178521 | 3300042601 | Bacteria | 5413 |
| 81 | Ga0466707_292380 | 3300042601 | Unclassified | 1773 |
| 82 | Ga0466715_236207 | 3300042616 | Bacteria | 9283 |
| 83 | Ga0466715_291298 | 3300042616 | Bacteria | 1222 |
| 84 | JGI24705J35276_12102483 | 3300002504 | Bacteria | 1022 |
| 85 | Ga0466704_368402 | 3300042643 | Bacteria | 8441 |
| 86 | Ga0466704_441037 | 3300042643 | Bacteria | 1384 |
| 87 | Ga0466708_025403 | 3300042652 | Bacteria | 89016 |
| 88 | Ga0123357_10118343 | 3300009784 | Bacteria | 3348 |
| 89 | Ga0123356_10030020 | 3300010049 | Bacteria | 5090 |
| 90 | Ga0123353_10146878 | 3300010167 | Bacteria | 3770 |
| 91 | Ga0466707_259060 | 3300042601 | Bacteria | 63426 |
| 92 | Ga0466707_391155 | 3300042601 | Bacteria | 1920 |
| 93 | Ga0466705_423453 | 3300042612 | Bacteria | 15086 |
| 94 | Ga0466711_073464 | 3300042615 | Bacteria | 29702 |
| 95 | Ga0466728_334818 | 3300042620 | Bacteria | 3543 |
| 96 | Ga0466703_226196 | 3300042636 | Bacteria | 17374 |
| 97 | Ga0466703_276763 | 3300042636 | Unclassified | 1031 |
| 98 | Ga0123357_10027635 | 3300009784 | Bacteria | 7672 |
| 99 | Ga0123353_10221665 | 3300010167 | Bacteria | 2956 |
| 100 | Ga0123353_10325115 | 3300010167 | Bacteria | 2331 |
| 101 | Ga0123354_10114126 | 3300010882 | Bacteria | 3542 |
| 102 | Ga0466696_373067 | 3300042596 | Bacteria | 4318 |
| 103 | Ga0466707_247224 | 3300042601 | Unclassified | 143661 |
| 104 | Ga0466719_411799 | 3300042606 | Bacteria | 13208 |
| 105 | Ga0466705_521894 | 3300042612 | Bacteria | 138507 |
| 106 | Ga0466726_182090 | 3300042619 | Bacteria | 107599 |
| 107 | Ga0466703_336258 | 3300042636 | Bacteria | 3530 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13614 | AAA_31 | AAA domain | 50 | 226 | 0.99 |
| PF01656 | CbiA | CobQ/CobB/MinD/ParA nucleotide binding domain | 52 | 277 | 0.95 |
| PF02374 | ArsA_ATPase | Anion-transporting ATPase | 54 | 90 | 0.91 |
| PF09140 | MipZ | ATPase MipZ | 52 | 92 | 0.9 |
| PF00142 | Fer4_NifH | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family | 52 | 96 | 0.85 |
| PF06564 | CBP_BcsQ | Cellulose biosynthesis protein BcsQ | 54 | 295 | 0.74 |
| PF10609 | ParA | NUBPL iron-transfer P-loop NTPase | 48 | 296 | 0.64 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.