Protein Family IF06057
Metagenome
Isolate
113
Members
52
Samples
107
Scaffolds
424.15
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_035786|Ga0466713_035786_163_1683
- Length
- 506 aa
- Sequence
- MNKKRNMTEFGYLRETSKDAEKAGVDKDSGLCRTGLDEYLSVIFPNVTDWVHDKKIPNAIQKLRGSKEEKGTRPDYRSESLNFIDLFAGAGGLSEGFIRAGYTPLAHIEMDKYACDTLKTRAAFHWLKANNQLQKYKKYLYEKQEKEDGSKLWKQVPTEIIDSVIHEAIGEDTIKDIFAKVDKLKGEKQVDIIIGGPPCQAYSIAGRARMGKAVKDDLRNELYKYYVKFLEHYQPKMFVFENVLGIRTAKNGEPFKDLKRLIEKAGYEMQDHIQTASQHGVLQNRQRIIIVGWKKGTSFHYPELAKEDSQYEVLKDLFIDLPERKHGEGQLCAPVKYTKPLSEMEYLKKSHIRNGFDFTTQHIARPNNENDREIYKMAVDMWLNKKKRIDYSKIPARLQHHKNKETFLNRFQVVDPYGCSHTVVAHIAMDGHYYIYPTLNPTIENVRSITIREAARLQSFPDNYYFEGSRSAAFRQIGNAVPVVLAHKIAEELKEQLQLWNTKKPK
Sample Types
Isolate
5.3%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.0%
Kalotermitidae
26.0%
Unclassified
8.0%
Blattidae
6.0%
Rhinotermitidae
4.0%
Termopsidae
4.0%
Hydrophilidae
2.0%
Hodotermitidae
2.0%
Drosophilidae
2.0%
Armadillidiidae
2.0%
Taxonomy
Archaea
2
Bacteria
103
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 2 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 19 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 23 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 30 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 39 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 44 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 45 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 46 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 47 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 48 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 49 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 50 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 51 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 52 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_040984 | 3300042612 | Bacteria | 16001 |
| 2 | Ga0123353_10106574 | 3300010167 | Bacteria | 4516 |
| 3 | Ga0466704_264769 | 3300042643 | Bacteria | 10143 |
| 4 | Ga0466709_086474 | 3300042648 | Bacteria | 4463 |
| 5 | Ga0466709_409482 | 3300042648 | Bacteria | 5241 |
| 6 | Ga0264413_157622 | 3300024493 | Bacteria | 1670 |
| 7 | Ga0466706_037386 | 3300042599 | Bacteria | 13377 |
| 8 | Ga0466705_529855 | 3300042612 | Bacteria | 6375 |
| 9 | Ga0466712_184139 | 3300042614 | Bacteria | 5275 |
| 10 | Ga0466711_126461 | 3300042615 | Bacteria | 11047 |
| 11 | JGI24695J34938_10047528 | 3300002450 | Bacteria | 1894 |
| 12 | JGI24696J40584_12961706 | 3300002834 | Unclassified | 42842 |
| 13 | Ga0466705_127568 | 3300042612 | Unclassified | 2715 |
| 14 | Ga0466732_039688 | 3300042656 | Bacteria | 8779 |
| 15 | Ga0466734_161664 | 3300042623 | Bacteria | 1355 |
| 16 | Ga0466703_166364 | 3300042636 | Unclassified | 6061 |
| 17 | Ga0466703_188537 | 3300042636 | Bacteria | 1828 |
| 18 | Ga0466690_169055 | 3300042590 | Bacteria | 2056 |
| 19 | Ga0466719_319777 | 3300042606 | Bacteria | 10176 |
| 20 | Ga0466722_179638 | 3300042609 | Bacteria | 8314 |
| 21 | Ga0466711_056072 | 3300042615 | Bacteria | 1819 |
| 22 | Ga0466711_244345 | 3300042615 | Bacteria | 13917 |
| 23 | Ga0466704_093527 | 3300042643 | Bacteria | 8370 |
| 24 | Ga0466704_133687 | 3300042643 | Bacteria | 22569 |
| 25 | Ga0466704_459072 | 3300042643 | Bacteria | 2581 |
| 26 | Ga0466704_463869 | 3300042643 | Bacteria | 13722 |
| 27 | Ga0466727_231548 | 3300042655 | Bacteria | 2850 |
| 28 | Ga0466692_067037 | 3300042591 | Bacteria | 8009 |
| 29 | Ga0466691_086181 | 3300042593 | Bacteria | 7052 |
| 30 | Ga0466713_035786 | 3300042602 | Bacteria | 10151 |
| 31 | Ga0466726_399534 | 3300042619 | Bacteria | 2026 |
| 32 | Ga0466728_045407 | 3300042620 | Unclassified | 1868 |
| 33 | AustNasuHG_c1016578 | 3300000089 | Archaea | 2463 |
| 34 | Ga0466705_358002 | 3300042612 | Bacteria | 8326 |
| 35 | Ga0466733_067953 | 3300042659 | Bacteria | 2646 |
| 36 | Ga0466702_046032 | 3300042635 | Bacteria | 8122 |
| 37 | Ga0466703_412555 | 3300042636 | Bacteria | 3055 |
| 38 | Ga0160469_100078 | 3300012824 | Bacteria | 157258 |
| 39 | Ga0466696_034297 | 3300042596 | Bacteria | 10574 |
| 40 | Ga0466716_080615 | 3300042605 | Bacteria | 2897 |
| 41 | Ga0466719_328311 | 3300042606 | Bacteria | 7549 |
| 42 | Ga0466722_187380 | 3300042609 | Bacteria | 52405 |
| 43 | Ga0466705_034500 | 3300042612 | Bacteria | 32983 |
| 44 | Ga0466733_113070 | 3300042659 | Bacteria | 30206 |
| 45 | Ga0123353_10355692 | 3300010167 | Bacteria | 2204 |
| 46 | Ga0123354_10202968 | 3300010882 | Bacteria | 2172 |
| 47 | Ga0466703_064008 | 3300042636 | Bacteria | 23112 |
| 48 | Ga0466727_291191 | 3300042655 | Bacteria | 8080 |
| 49 | Ga0466657_211023 | 3300042582 | Bacteria | 11625 |
| 50 | Ga0466696_181024 | 3300042596 | Unclassified | 1987 |
| 51 | Ga0466718_036683 | 3300042617 | Bacteria | 12120 |
| 52 | Ga0466726_167460 | 3300042619 | Bacteria | 2071 |
| 53 | JGI24698J34947_10036025 | 3300002449 | Bacteria | 2578 |
| 54 | JGI24702J35022_10025772 | 3300002462 | Bacteria | 3170 |
| 55 | Ga0072941_1019363 | 3300005201 | Bacteria | 8849 |
| 56 | Ga0104048_1000401 | 3300007143 | Bacteria | 6083 |
| 57 | Ga0466733_054332 | 3300042659 | Bacteria | 3033 |
| 58 | Ga0123356_10018350 | 3300010049 | Bacteria | 6644 |
| 59 | Ga0123356_10230362 | 3300010049 | Bacteria | 1916 |
| 60 | Ga0123353_10243377 | 3300010167 | Bacteria | 2793 |
| 61 | Ga0123354_10022485 | 3300010882 | Archaea | 9941 |
| 62 | Ga0466709_027522 | 3300042648 | Bacteria | 7142 |
| 63 | Ga0415639_256044 | 3300038395 | Bacteria | 2197 |
| 64 | Ga0466690_017605 | 3300042590 | Bacteria | 5054 |
| 65 | Ga0466699_079470 | 3300042597 | Bacteria | 9668 |
| 66 | Ga0466700_111318 | 3300042600 | Bacteria | 2686 |
| 67 | Ga0466707_365186 | 3300042601 | Bacteria | 9948 |
| 68 | Ga0466711_087610 | 3300042615 | Bacteria | 23108 |
| 69 | Ga0466711_091278 | 3300042615 | Bacteria | 10484 |
| 70 | Ga0466723_286915 | 3300042618 | Bacteria | 7048 |
| 71 | Ga0466726_074679 | 3300042619 | Bacteria | 1631 |
| 72 | Ga0466728_094173 | 3300042620 | Bacteria | 13476 |
| 73 | JGI24702J35022_10000755 | 3300002462 | Bacteria | 19995 |
| 74 | JGI24702J35022_10061582 | 3300002462 | Bacteria | 2008 |
| 75 | Ga0466705_287416 | 3300042612 | Bacteria | 6675 |
| 76 | Ga0123356_10014872 | 3300010049 | Bacteria | 7470 |
| 77 | Ga0466702_299964 | 3300042635 | Bacteria | 1594 |
| 78 | Ga0466709_248007 | 3300042648 | Bacteria | 12256 |
| 79 | Ga0264413_131007 | 3300024493 | Bacteria | 1939 |
| 80 | Ga0264413_131008 | 3300024493 | Bacteria | 1725 |
| 81 | Ga0466691_118611 | 3300042593 | Bacteria | 4308 |
| 82 | Ga0466694_027211 | 3300042594 | Bacteria | 5584 |
| 83 | Ga0466694_292704 | 3300042594 | Bacteria | 4970 |
| 84 | Ga0466706_050332 | 3300042599 | Bacteria | 11066 |
| 85 | Ga0466706_077176 | 3300042599 | Bacteria | 26843 |
| 86 | Ga0466707_274644 | 3300042601 | Bacteria | 11512 |
| 87 | Ga0466714_028810 | 3300042603 | Bacteria | 9823 |
| 88 | Ga0466705_518227 | 3300042612 | Bacteria | 2244 |
| 89 | Ga0466711_203096 | 3300042615 | Bacteria | 9191 |
| 90 | Ga0466715_076935 | 3300042616 | Unclassified | 12690 |
| 91 | Ga0466718_138035 | 3300042617 | Bacteria | 4938 |
| 92 | Ga0466697_231340 | 3300042611 | Bacteria | 1547 |
| 93 | Ga0123353_10420235 | 3300010167 | Bacteria | 1981 |
| 94 | Ga0466704_160335 | 3300042643 | Unclassified | 12062 |
| 95 | Ga0466709_276823 | 3300042648 | Bacteria | 10129 |
| 96 | Ga0466727_291014 | 3300042655 | Bacteria | 7053 |
| 97 | Ga0466694_195559 | 3300042594 | Bacteria | 5495 |
| 98 | Ga0466706_184587 | 3300042599 | Bacteria | 12285 |
| 99 | Ga0466716_177147 | 3300042605 | Bacteria | 1718 |
| 100 | Ga0466716_546833 | 3300042605 | Bacteria | 4931 |
| 101 | Ga0466719_030102 | 3300042606 | Bacteria | 15548 |
| 102 | Ga0466720_077982 | 3300042607 | Bacteria | 9246 |
| 103 | Ga0466722_144517 | 3300042609 | Bacteria | 1807 |
| 104 | Ga0466712_020399 | 3300042614 | Bacteria | 14944 |
| 105 | Ga0466711_000937 | 3300042615 | Bacteria | 7284 |
| 106 | Ga0466723_185625 | 3300042618 | Bacteria | 4174 |
| 107 | JGI24698J34947_10033876 | 3300002449 | Unclassified | 2676 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00145 | DNA_methylase | C-5 cytosine-specific DNA methylase | 82 | 122 | 0.88 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00145 | GO:0008168 | methyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.