Protein Family IF05967
Metagenome
105
Members
27
Samples
105
Scaffolds
302.64
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_339569|Ga0466707_339569_528_1472
- Length
- 314 aa
- Sequence
- MLETGIVAVLQREFIYFWYYFEIQFRQIFGYWVLGMALGSVISVFGKDSIHRAFAGMRDKKLGALGVIPASLLGIASPLCMYGTIPIAASFAEKGMAEDWIAAFCMSSILLNPQLLFYSAALGPTALAIRFITCFLCGAAAGLCVRVFFKKKPFFRFTGFYAGTENHDTDPNPVLRLLKNFLRNIKATGLYFLIGIVLSALFQRYVPPDGFAKLFGSGRHGFGVLMAATVGVPVYVCGGGTIPLLVEWLRNGMSMGSATAFMLTGPATKITNLGAVKIVLGMKNFVLYLLFTMLFAFMSGVFVDWCIRALAVYK
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
53.8%
Termitidae
23.1%
Rhinotermitidae
11.5%
Termopsidae
7.7%
Unclassified
3.8%
Taxonomy
Archaea
1
Bacteria
90
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 16 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_339569 | 3300042601 | Bacteria | 2115 |
| 2 | Ga0466719_077102 | 3300042606 | Bacteria | 3856 |
| 3 | Ga0466695_005119 | 3300042595 | Bacteria | 3063 |
| 4 | Ga0466703_185697 | 3300042636 | Bacteria | 25709 |
| 5 | Ga0466704_202160 | 3300042643 | Bacteria | 1306 |
| 6 | Ga0466704_367015 | 3300042643 | Bacteria | 11571 |
| 7 | Ga0466705_415743 | 3300042612 | Bacteria | 5427 |
| 8 | Ga0466712_182133 | 3300042614 | Bacteria | 6525 |
| 9 | Ga0466711_046456 | 3300042615 | Bacteria | 9489 |
| 10 | Ga0466723_138167 | 3300042618 | Bacteria | 7231 |
| 11 | Ga0466726_007599 | 3300042619 | Bacteria | 9503 |
| 12 | Ga0466728_112941 | 3300042620 | Bacteria | 4042 |
| 13 | Ga0466728_162551 | 3300042620 | Bacteria | 5745 |
| 14 | Ga0466728_205882 | 3300042620 | Bacteria | 1224 |
| 15 | Ga0466733_184996 | 3300042659 | Unclassified | 2046 |
| 16 | Ga0072941_1004857 | 3300005201 | Unclassified | 14339 |
| 17 | Ga0466719_080739 | 3300042606 | Bacteria | 19547 |
| 18 | Ga0466703_010414 | 3300042636 | Bacteria | 8127 |
| 19 | Ga0466703_201279 | 3300042636 | Bacteria | 1348 |
| 20 | Ga0466704_247065 | 3300042643 | Unclassified | 1259 |
| 21 | Ga0466704_608704 | 3300042643 | Bacteria | 2547 |
| 22 | Ga0466704_622319 | 3300042643 | Bacteria | 6830 |
| 23 | Ga0466709_351380 | 3300042648 | Bacteria | 3720 |
| 24 | Ga0466728_432725 | 3300042620 | Bacteria | 3271 |
| 25 | Ga0466705_082272 | 3300042612 | Bacteria | 8216 |
| 26 | Ga0466705_211341 | 3300042612 | Bacteria | 7695 |
| 27 | Ga0466705_229994 | 3300042612 | Bacteria | 2639 |
| 28 | Ga0466719_151859 | 3300042606 | Bacteria | 4701 |
| 29 | Ga0466719_321974 | 3300042606 | Bacteria | 26448 |
| 30 | Ga0415639_077710 | 3300038395 | Unclassified | 4220 |
| 31 | Ga0466690_062648 | 3300042590 | Bacteria | 8325 |
| 32 | Ga0466696_079495 | 3300042596 | Bacteria | 2326 |
| 33 | Ga0466703_130567 | 3300042636 | Bacteria | 4640 |
| 34 | Ga0466704_120416 | 3300042643 | Bacteria | 30382 |
| 35 | Ga0466704_270988 | 3300042643 | Bacteria | 24720 |
| 36 | Ga0466728_075088 | 3300042620 | Bacteria | 1670 |
| 37 | Ga0466728_096187 | 3300042620 | Bacteria | 5802 |
| 38 | Ga0466728_101731 | 3300042620 | Bacteria | 11817 |
| 39 | Ga0466719_000307 | 3300042606 | Bacteria | 2975 |
| 40 | Ga0456237_0012842 | 3300041968 | Unclassified | 1207 |
| 41 | Ga0466690_135182 | 3300042590 | Bacteria | 2239 |
| 42 | Ga0466704_035118 | 3300042643 | Bacteria | 4401 |
| 43 | Ga0466704_036237 | 3300042643 | Bacteria | 2456 |
| 44 | Ga0466704_434098 | 3300042643 | Bacteria | 82573 |
| 45 | Ga0466709_237340 | 3300042648 | Bacteria | 2616 |
| 46 | Ga0466711_294510 | 3300042615 | Bacteria | 8916 |
| 47 | Ga0466723_137349 | 3300042618 | Bacteria | 5699 |
| 48 | Ga0466723_227797 | 3300042618 | Bacteria | 5279 |
| 49 | Ga0466726_126520 | 3300042619 | Bacteria | 1415 |
| 50 | Ga0466728_030049 | 3300042620 | Bacteria | 2065 |
| 51 | Ga0466728_150957 | 3300042620 | Bacteria | 1995 |
| 52 | Ga0466728_226329 | 3300042620 | Unclassified | 1118 |
| 53 | Ga0466705_049163 | 3300042612 | Bacteria | 6741 |
| 54 | Ga0123356_10144179 | 3300010049 | Bacteria | 2354 |
| 55 | Ga0466707_213253 | 3300042601 | Unclassified | 1019 |
| 56 | Ga0466707_395127 | 3300042601 | Unclassified | 1033 |
| 57 | Ga0466690_327770 | 3300042590 | Bacteria | 1155 |
| 58 | Ga0466691_033083 | 3300042593 | Bacteria | 3761 |
| 59 | Ga0466735_067989 | 3300042624 | Unclassified | 3296 |
| 60 | Ga0466735_127739 | 3300042624 | Bacteria | 1308 |
| 61 | Ga0466723_323862 | 3300042618 | Bacteria | 13939 |
| 62 | Ga0466726_042911 | 3300042619 | Bacteria | 3025 |
| 63 | Ga0466726_096021 | 3300042619 | Unclassified | 6323 |
| 64 | Ga0466705_010923 | 3300042612 | Bacteria | 5698 |
| 65 | Ga0466705_180006 | 3300042612 | Bacteria | 14139 |
| 66 | Ga0466719_181010 | 3300042606 | Bacteria | 14792 |
| 67 | Ga0466719_309527 | 3300042606 | Bacteria | 3292 |
| 68 | Ga0466703_058560 | 3300042636 | Bacteria | 3418 |
| 69 | Ga0466703_175647 | 3300042636 | Bacteria | 3027 |
| 70 | Ga0466704_115382 | 3300042643 | Bacteria | 7098 |
| 71 | Ga0466704_232712 | 3300042643 | Bacteria | 11168 |
| 72 | Ga0466715_595088 | 3300042616 | Bacteria | 4599 |
| 73 | Ga0466723_193985 | 3300042618 | Bacteria | 2129 |
| 74 | Ga0466726_041759 | 3300042619 | Bacteria | 1199 |
| 75 | Ga0466726_056568 | 3300042619 | Archaea | 3976 |
| 76 | Ga0466728_134033 | 3300042620 | Bacteria | 6092 |
| 77 | Ga0466705_013181 | 3300042612 | Bacteria | 3558 |
| 78 | Ga0466705_048869 | 3300042612 | Unclassified | 4979 |
| 79 | Ga0466705_080622 | 3300042612 | Bacteria | 10577 |
| 80 | Ga0466722_062068 | 3300042609 | Bacteria | 1954 |
| 81 | Ga0466690_071716 | 3300042590 | Bacteria | 11302 |
| 82 | Ga0466690_180072 | 3300042590 | Unclassified | 1442 |
| 83 | Ga0466690_194552 | 3300042590 | Bacteria | 2481 |
| 84 | Ga0466691_034646 | 3300042593 | Bacteria | 10784 |
| 85 | Ga0466691_221539 | 3300042593 | Bacteria | 5482 |
| 86 | Ga0466694_107532 | 3300042594 | Bacteria | 21959 |
| 87 | Ga0466729_218495 | 3300042621 | Unclassified | 1709 |
| 88 | Ga0466735_055146 | 3300042624 | Bacteria | 2773 |
| 89 | Ga0466703_358754 | 3300042636 | Bacteria | 14270 |
| 90 | Ga0466728_001779 | 3300042620 | Bacteria | 2490 |
| 91 | Ga0466728_388274 | 3300042620 | Bacteria | 2445 |
| 92 | Ga0466705_129516 | 3300042612 | Bacteria | 2400 |
| 93 | Ga0466705_268849 | 3300042612 | Bacteria | 3835 |
| 94 | Ga0466733_051499 | 3300042659 | Bacteria | 21579 |
| 95 | Ga0466707_279281 | 3300042601 | Bacteria | 3320 |
| 96 | Ga0466716_047003 | 3300042605 | Unclassified | 7238 |
| 97 | Ga0466716_120423 | 3300042605 | Bacteria | 6286 |
| 98 | Ga0466704_145582 | 3300042643 | Bacteria | 1577 |
| 99 | Ga0466709_125418 | 3300042648 | Bacteria | 2616 |
| 100 | Ga0466708_189217 | 3300042652 | Bacteria | 3681 |
| 101 | Ga0466715_115606 | 3300042616 | Bacteria | 4398 |
| 102 | Ga0466715_588110 | 3300042616 | Bacteria | 16163 |
| 103 | Ga0466726_399823 | 3300042619 | Bacteria | 2433 |
| 104 | Ga0466728_020637 | 3300042620 | Bacteria | 8786 |
| 105 | Ga0466728_182892 | 3300042620 | Bacteria | 3096 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03773 | ArsP_1 | Predicted permease | 29 | 302 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.