Protein Family IF05935
Metagenome
Isolate
116
Members
34
Samples
114
Scaffolds
124.23
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_277106|Ga0466707_277106_317_757
- Length
- 146 aa
- Sequence
- MAEYRTERIGSLVQEKISGLILEQRIKDPRVSPFLSITRVKISRDLAYADVYVSNIRAEANISKGVEGLQSAAGFIQAQLAGMMHIRKTPRLRFHEDTSIREGFDLVKKIEALVPGIQSENPAHDQTTGTNDGQNDKGTEGDAGGN
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
42.4%
Termitidae
27.3%
Unclassified
12.1%
Rhinotermitidae
9.1%
Termopsidae
9.1%
Taxonomy
Archaea
1
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
0
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 26 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24702J35022_10037297 | 3300002462 | Bacteria | 2596 |
| 2 | Ga0466692_046686 | 3300042591 | Bacteria | 13737 |
| 3 | Ga0466691_043710 | 3300042593 | Bacteria | 12405 |
| 4 | Ga0466707_109688 | 3300042601 | Bacteria | 1352 |
| 5 | Ga0466722_052510 | 3300042609 | Bacteria | 6421 |
| 6 | Ga0466731_363083 | 3300042622 | Bacteria | 2188 |
| 7 | Ga0466735_223429 | 3300042624 | Bacteria | 1378 |
| 8 | Ga0466709_386244 | 3300042648 | Bacteria | 35005 |
| 9 | Ga0466708_024334 | 3300042652 | Bacteria | 6581 |
| 10 | Ga0466708_334123 | 3300042652 | Bacteria | 55617 |
| 11 | Ga0466723_269175 | 3300042618 | Bacteria | 8887 |
| 12 | Ga0466726_107078 | 3300042619 | Archaea | 1272 |
| 13 | Ga0466726_196448 | 3300042619 | Bacteria | 9029 |
| 14 | Ga0466705_033406 | 3300042612 | Bacteria | 8523 |
| 15 | Ga0068305_10003759 | 3300005083 | Bacteria | 7155 |
| 16 | Ga0466690_350161 | 3300042590 | Bacteria | 1918 |
| 17 | Ga0466691_101290 | 3300042593 | Bacteria | 2319 |
| 18 | Ga0466691_137217 | 3300042593 | Bacteria | 13507 |
| 19 | Ga0466719_205839 | 3300042606 | Bacteria | 12424 |
| 20 | Ga0466722_012141 | 3300042609 | Bacteria | 1201 |
| 21 | Ga0466703_007280 | 3300042636 | Bacteria | 56110 |
| 22 | Ga0466703_082365 | 3300042636 | Bacteria | 9121 |
| 23 | Ga0466704_560818 | 3300042643 | Bacteria | 13493 |
| 24 | Ga0466709_315804 | 3300042648 | Bacteria | 1217 |
| 25 | Ga0466711_268990 | 3300042615 | Bacteria | 23304 |
| 26 | Ga0466715_452394 | 3300042616 | Bacteria | 5450 |
| 27 | Ga0466726_110912 | 3300042619 | Bacteria | 17782 |
| 28 | Ga0466726_463302 | 3300042619 | Bacteria | 1355 |
| 29 | Ga0466732_305090 | 3300042656 | Bacteria | 1648 |
| 30 | Ga0072941_1076468 | 3300005201 | Bacteria | 3452 |
| 31 | Ga0466690_371547 | 3300042590 | Bacteria | 2271 |
| 32 | Ga0466691_006758 | 3300042593 | Bacteria | 4377 |
| 33 | Ga0466722_014301 | 3300042609 | Bacteria | 3681 |
| 34 | Ga0466722_131757 | 3300042609 | Bacteria | 1807 |
| 35 | Ga0466727_273302 | 3300042655 | Bacteria | 1637 |
| 36 | Ga0466727_325621 | 3300042655 | Bacteria | 1841 |
| 37 | Ga0466711_411128 | 3300042615 | Bacteria | 3845 |
| 38 | Ga0466715_318665 | 3300042616 | Bacteria | 8225 |
| 39 | Ga0466723_031643 | 3300042618 | Bacteria | 15121 |
| 40 | Ga0466723_186275 | 3300042618 | Bacteria | 12600 |
| 41 | Ga0466726_272622 | 3300042619 | Bacteria | 1239 |
| 42 | Ga0466728_164776 | 3300042620 | Bacteria | 7744 |
| 43 | Ga0466701_102578 | 3300042598 | Bacteria | 1930 |
| 44 | Ga0466719_100574 | 3300042606 | Bacteria | 6347 |
| 45 | Ga0466719_245587 | 3300042606 | Bacteria | 2337 |
| 46 | Ga0466720_008231 | 3300042607 | Bacteria | 18136 |
| 47 | Ga0466722_257104 | 3300042609 | Bacteria | 2765 |
| 48 | Ga0466727_345400 | 3300042655 | Bacteria | 2554 |
| 49 | Ga0466711_493202 | 3300042615 | Bacteria | 1205 |
| 50 | Ga0466715_226708 | 3300042616 | Bacteria | 15288 |
| 51 | Ga0466718_069383 | 3300042617 | Bacteria | 2283 |
| 52 | Ga0072941_1202585 | 3300005201 | Bacteria | 720 |
| 53 | Ga0466692_039725 | 3300042591 | Bacteria | 1285 |
| 54 | Ga0466692_194201 | 3300042591 | Bacteria | 25588 |
| 55 | Ga0466691_008319 | 3300042593 | Bacteria | 5307 |
| 56 | Ga0466696_021913 | 3300042596 | Bacteria | 3628 |
| 57 | Ga0466707_382044 | 3300042601 | Bacteria | 1994 |
| 58 | Ga0466716_111654 | 3300042605 | Bacteria | 3866 |
| 59 | Ga0123353_13230207 | 3300010167 | Bacteria | 522 |
| 60 | Ga0466735_070473 | 3300042624 | Bacteria | 2323 |
| 61 | Ga0466704_502606 | 3300042643 | Bacteria | 46691 |
| 62 | Ga0466708_252693 | 3300042652 | Bacteria | 4422 |
| 63 | Ga0466723_006168 | 3300042618 | Bacteria | 4643 |
| 64 | Ga0466726_259049 | 3300042619 | Bacteria | 2410 |
| 65 | Ga0466705_302266 | 3300042612 | Bacteria | 11954 |
| 66 | Ga0074263_119811 | 3300005485 | Bacteria | 882 |
| 67 | Ga0466690_131961 | 3300042590 | Bacteria | 7990 |
| 68 | Ga0466691_174737 | 3300042593 | Bacteria | 28818 |
| 69 | Ga0466696_149080 | 3300042596 | Bacteria | 15422 |
| 70 | Ga0466696_201339 | 3300042596 | Bacteria | 1482 |
| 71 | Ga0466707_114633 | 3300042601 | Bacteria | 1171 |
| 72 | Ga0466707_329578 | 3300042601 | Bacteria | 1174 |
| 73 | Ga0466704_061736 | 3300042643 | Bacteria | 14291 |
| 74 | Ga0466704_414513 | 3300042643 | Bacteria | 12717 |
| 75 | Ga0466712_278255 | 3300042614 | Bacteria | 2440 |
| 76 | Ga0466715_012035 | 3300042616 | Bacteria | 2021 |
| 77 | Ga0466715_034376 | 3300042616 | Bacteria | 13276 |
| 78 | Ga0466715_119832 | 3300042616 | Bacteria | 18314 |
| 79 | Ga0466718_007225 | 3300042617 | Bacteria | 1485 |
| 80 | Ga0466723_102176 | 3300042618 | Bacteria | 1387 |
| 81 | Ga0466723_145445 | 3300042618 | Bacteria | 1387 |
| 82 | Ga0466726_253141 | 3300042619 | Bacteria | 2223 |
| 83 | Ga0466728_057784 | 3300042620 | Bacteria | 27137 |
| 84 | Ga0466705_024854 | 3300042612 | Bacteria | 10332 |
| 85 | Ga0466696_126792 | 3300042596 | Bacteria | 1382 |
| 86 | Ga0466707_199862 | 3300042601 | Bacteria | 6985 |
| 87 | Ga0466707_405534 | 3300042601 | Bacteria | 1204 |
| 88 | Ga0466716_468750 | 3300042605 | Bacteria | 1656 |
| 89 | Ga0466716_471127 | 3300042605 | Bacteria | 1262 |
| 90 | Ga0466722_020937 | 3300042609 | Bacteria | 5543 |
| 91 | Ga0466735_009121 | 3300042624 | Bacteria | 3952 |
| 92 | Ga0466735_096823 | 3300042624 | Bacteria | 1136 |
| 93 | Ga0466703_299957 | 3300042636 | Bacteria | 14017 |
| 94 | Ga0466727_224981 | 3300042655 | Bacteria | 4382 |
| 95 | Ga0466727_286206 | 3300042655 | Bacteria | 1654 |
| 96 | Ga0466723_101950 | 3300042618 | Bacteria | 6516 |
| 97 | Ga0466723_317502 | 3300042618 | Bacteria | 1158 |
| 98 | Ga0466705_135115 | 3300042612 | Bacteria | 10570 |
| 99 | Ga0466691_053463 | 3300042593 | Bacteria | 19874 |
| 100 | Ga0466707_277106 | 3300042601 | Bacteria | 2037 |
| 101 | Ga0466716_403383 | 3300042605 | Bacteria | 1971 |
| 102 | Ga0466719_357574 | 3300042606 | Bacteria | 3351 |
| 103 | Ga0466722_018091 | 3300042609 | Bacteria | 12871 |
| 104 | Ga0466722_178140 | 3300042609 | Bacteria | 41336 |
| 105 | Ga0466729_282689 | 3300042621 | Bacteria | 1108 |
| 106 | Ga0466735_027276 | 3300042624 | Bacteria | 26494 |
| 107 | Ga0466703_282273 | 3300042636 | Bacteria | 7474 |
| 108 | Ga0466704_520172 | 3300042643 | Bacteria | 7280 |
| 109 | Ga0466709_025099 | 3300042648 | Bacteria | 18423 |
| 110 | Ga0466708_166872 | 3300042652 | Bacteria | 11631 |
| 111 | Ga0466727_309973 | 3300042655 | Bacteria | 6096 |
| 112 | Ga0466711_198128 | 3300042615 | Bacteria | 8319 |
| 113 | Ga0466711_508344 | 3300042615 | Bacteria | 1151 |
| 114 | Ga0466723_256585 | 3300042618 | Bacteria | 34051 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02033 | RBFA | Ribosome-binding factor A | 5 | 106 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02033 | GO:0006364 | rRNA processing | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.