Protein Family IF05909
Metagenome
Isolate
104
Members
40
Samples
101
Scaffolds
184.93
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_228494|Ga0466707_228494_328_882
- Length
- 184 aa
- Sequence
- MIDKDIIENIIKLRENGFEKDKDHFSITRDIFTARLESFITGTGKYLEAAVIGEIGNNTFDHNFIFENMNQKGVYFNFYTEHVILSDYGRGIKESLSQVIPNIQTDFEALEIAFTKNISGRSPEQRGNGLKFVSKTIQENNWNLFFQSGNGNCFINKDGIKYTQSNILISGCLAIINFNGGKKS
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.2%
Kalotermitidae
33.3%
Unclassified
10.3%
Termopsidae
7.7%
Rhinotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
99
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 3 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 13 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 14 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 17 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 18 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 19 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 20 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466699_220319 | 3300042597 | Bacteria | 6448 |
| 2 | AustNasuHG_c1000793 | 3300000089 | Unclassified | 11306 |
| 3 | AustNasuHG_c1057019 | 3300000089 | Bacteria | 782 |
| 4 | JGI24698J34947_10157751 | 3300002449 | Bacteria | 934 |
| 5 | JGI24696J40584_12850358 | 3300002834 | Bacteria | 979 |
| 6 | Ga0466727_142246 | 3300042655 | Bacteria | 4021 |
| 7 | Ga0466727_346167 | 3300042655 | Bacteria | 1990 |
| 8 | Ga0466718_158603 | 3300042617 | Bacteria | 6249 |
| 9 | Ga0466719_110706 | 3300042606 | Bacteria | 1233 |
| 10 | Ga0466720_031375 | 3300042607 | Bacteria | 1031 |
| 11 | Ga0466705_217524 | 3300042612 | Bacteria | 4878 |
| 12 | Ga0466694_070366 | 3300042594 | Bacteria | 1483 |
| 13 | Ga0466699_126032 | 3300042597 | Bacteria | 2367 |
| 14 | Ga0466699_159650 | 3300042597 | Bacteria | 5388 |
| 15 | Ga0466699_290165 | 3300042597 | Bacteria | 2761 |
| 16 | AustNasuHG_c1000434 | 3300000089 | Bacteria | 14622 |
| 17 | Ga0072941_1002036 | 3300005201 | Bacteria | 1374 |
| 18 | Ga0123356_10003747 | 3300010049 | Bacteria | 15846 |
| 19 | Ga0123356_10075709 | 3300010049 | Bacteria | 3170 |
| 20 | Ga0466735_091383 | 3300042624 | Bacteria | 1185 |
| 21 | Ga0466711_374414 | 3300042615 | Bacteria | 4543 |
| 22 | Ga0466723_114938 | 3300042618 | Bacteria | 9924 |
| 23 | Ga0466733_023989 | 3300042659 | Bacteria | 3809 |
| 24 | Ga0466690_360226 | 3300042590 | Bacteria | 1370 |
| 25 | JGI24698J34947_10033321 | 3300002449 | Bacteria | 2703 |
| 26 | Ga0074263_116590 | 3300005485 | Bacteria | 2561 |
| 27 | Ga0123357_10653016 | 3300009784 | Bacteria | 777 |
| 28 | Ga0123356_10058885 | 3300010049 | Bacteria | 3583 |
| 29 | Ga0123356_10649597 | 3300010049 | Bacteria | 1222 |
| 30 | Ga0466704_571398 | 3300042643 | Bacteria | 3987 |
| 31 | Ga0466709_130119 | 3300042648 | Unclassified | 1106 |
| 32 | Ga0466708_398007 | 3300042652 | Bacteria | 1936 |
| 33 | Ga0466707_062045 | 3300042601 | Bacteria | 1069 |
| 34 | Ga0466716_053459 | 3300042605 | Bacteria | 5839 |
| 35 | Ga0466732_450785 | 3300042656 | Bacteria | 1803 |
| 36 | Ga0466690_148995 | 3300042590 | Bacteria | 1809 |
| 37 | Ga0466690_184732 | 3300042590 | Bacteria | 1905 |
| 38 | Ga0466695_141338 | 3300042595 | Bacteria | 4553 |
| 39 | Ga0466699_354451 | 3300042597 | Bacteria | 3332 |
| 40 | AustNasuHG_c1004172 | 3300000089 | Bacteria | 5193 |
| 41 | AustNasuHG_c1030611 | 3300000089 | Bacteria | 1545 |
| 42 | JGI24695J34938_10013666 | 3300002450 | Bacteria | 4252 |
| 43 | Ga0072941_1046244 | 3300005201 | Bacteria | 4886 |
| 44 | Ga0123357_10082090 | 3300009784 | Bacteria | 4234 |
| 45 | Ga0466703_209752 | 3300042636 | Bacteria | 1236 |
| 46 | Ga0466704_579289 | 3300042643 | Bacteria | 2568 |
| 47 | Ga0466719_060797 | 3300042606 | Bacteria | 1331 |
| 48 | Ga0466720_001772 | 3300042607 | Bacteria | 5052 |
| 49 | Ga0466720_030037 | 3300042607 | Bacteria | 1468 |
| 50 | Ga0466732_118369 | 3300042656 | Bacteria | 1193 |
| 51 | Ga0466696_074401 | 3300042596 | Bacteria | 1202 |
| 52 | Ga0466699_338698 | 3300042597 | Bacteria | 62334 |
| 53 | Ga0466699_363902 | 3300042597 | Bacteria | 3833 |
| 54 | AustNasuHG_c1009489 | 3300000089 | Bacteria | 3415 |
| 55 | JGI24698J34947_10026507 | 3300002449 | Bacteria | 3079 |
| 56 | Ga0072940_1183899 | 3300005200 | Bacteria | 1028 |
| 57 | Ga0072941_1106777 | 3300005201 | Bacteria | 1370 |
| 58 | Ga0123357_10329534 | 3300009784 | Bacteria | 1494 |
| 59 | Ga0123356_10381055 | 3300010049 | Bacteria | 1543 |
| 60 | Ga0123356_11709364 | 3300010049 | Bacteria | 781 |
| 61 | Ga0466718_078627 | 3300042617 | Bacteria | 5896 |
| 62 | Ga0466718_083734 | 3300042617 | Bacteria | 14036 |
| 63 | Ga0466718_115533 | 3300042617 | Bacteria | 1375 |
| 64 | Ga0466726_284108 | 3300042619 | Bacteria | 2358 |
| 65 | Ga0466707_235155 | 3300042601 | Bacteria | 1455 |
| 66 | Ga0466720_113496 | 3300042607 | Bacteria | 1362 |
| 67 | Ga0466690_136734 | 3300042590 | Bacteria | 2424 |
| 68 | Ga0466699_061551 | 3300042597 | Bacteria | 3991 |
| 69 | Ga0466699_097544 | 3300042597 | Bacteria | 2833 |
| 70 | Ga0466699_374590 | 3300042597 | Unclassified | 2164 |
| 71 | Ga0466727_296807 | 3300042655 | Bacteria | 1370 |
| 72 | Ga0466705_506687 | 3300042612 | Bacteria | 4904 |
| 73 | Ga0466715_236216 | 3300042616 | Bacteria | 1619 |
| 74 | Ga0466718_026131 | 3300042617 | Bacteria | 1071 |
| 75 | Ga0466723_011137 | 3300042618 | Bacteria | 7967 |
| 76 | Ga0466723_052655 | 3300042618 | Bacteria | 4529 |
| 77 | Ga0466722_196854 | 3300042609 | Bacteria | 4870 |
| 78 | Ga0466694_385670 | 3300042594 | Bacteria | 1275 |
| 79 | Ga0466699_182313 | 3300042597 | Bacteria | 3086 |
| 80 | AustNasuHG_c1038878 | 3300000089 | Bacteria | 1190 |
| 81 | Ga0466703_146962 | 3300042636 | Bacteria | 1137 |
| 82 | Ga0466718_026240 | 3300042617 | Bacteria | 37188 |
| 83 | Ga0466726_059699 | 3300042619 | Bacteria | 1035 |
| 84 | Ga0466707_228494 | 3300042601 | Bacteria | 1608 |
| 85 | Ga0466720_110680 | 3300042607 | Bacteria | 1229 |
| 86 | Ga0466733_217185 | 3300042659 | Unclassified | 1111 |
| 87 | AustNasuHG_c1012318 | 3300000089 | Bacteria | 2952 |
| 88 | JGI24702J35022_10077214 | 3300002462 | Bacteria | 1801 |
| 89 | Ga0123357_10390634 | 3300009784 | Bacteria | 1279 |
| 90 | Ga0123353_10980631 | 3300010167 | Bacteria | 1138 |
| 91 | Ga0123353_11872983 | 3300010167 | Unclassified | 741 |
| 92 | Ga0466702_199105 | 3300042635 | Bacteria | 1727 |
| 93 | Ga0466703_150698 | 3300042636 | Bacteria | 2683 |
| 94 | Ga0466727_059442 | 3300042655 | Bacteria | 2779 |
| 95 | Ga0466727_306007 | 3300042655 | Bacteria | 1342 |
| 96 | Ga0466723_100648 | 3300042618 | Bacteria | 2382 |
| 97 | Ga0466726_371740 | 3300042619 | Bacteria | 1476 |
| 98 | Ga0466726_374836 | 3300042619 | Bacteria | 1002 |
| 99 | Ga0466726_394928 | 3300042619 | Bacteria | 1080 |
| 100 | Ga0466728_011218 | 3300042620 | Bacteria | 6040 |
| 101 | Ga0466707_138136 | 3300042601 | Bacteria | 1831 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.