Protein Family IF05883
Metagenome
Isolate
157
Members
46
Samples
146
Scaffolds
386.02
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_193383|Ga0466707_193383_906_2231
- Length
- 441 aa
- Sequence
- LHIITPLGSVYNGLSGFPCAASEKSSFRIEFPAIIYHNELLISRYCFLKEEFMKNLFKGFGFILLAAALTFPVFAGXXXXEKASGDVIRIGVFEPMTGANAAGGAMEVEGIRLANELYPTVEVAGKTYKVELFVSDNKSDKVEAATAVQRLIDGNKVQVILGSWGSSLSMAGGEVARDAKIPVIGLSCTNPLVTAGNDYYFRVCFIDPFQGVVMSNYAYNDLKAKTAVIVQEVSNDYSVGLAKFFSDNFKKLTGNNNAILATVNYNTGDQDFSAQLTTIRTSRPDVIFAPGNYTESALVIKQARELGITIPIIGGDTWETPEFIDVGKERVEGAVFSTFFASEHAATPLAETFLKEYRSRYNREPAAVTALGFDGYLVALDAIKRAGSIAPQAIRDAIAKTSGFVGVTGTTTLDSNGDATKSAFIKAVQGGEFVFKTIVNP
Sample Types
Isolate
7.0%
Metagenome
93.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
33.3%
Termitidae
31.1%
Unclassified
17.8%
Rhinotermitidae
6.7%
Termopsidae
6.7%
Stratiomyidae
2.2%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 12 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 13 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 14 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 24 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 25 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 43 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 44 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 45 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 46 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_035491 | 3300042612 | Bacteria | 7574 |
| 2 | Ga0466705_112086 | 3300042612 | Bacteria | 12461 |
| 3 | Ga0466718_047805 | 3300042617 | Bacteria | 5384 |
| 4 | Ga0466726_146196 | 3300042619 | Bacteria | 1484 |
| 5 | Ga0466726_415802 | 3300042619 | Bacteria | 5822 |
| 6 | Ga0466729_208015 | 3300042621 | Bacteria | 4221 |
| 7 | Ga0466704_522007 | 3300042643 | Bacteria | 15059 |
| 8 | Ga0466709_067006 | 3300042648 | Bacteria | 8000 |
| 9 | Ga0415639_001807 | 3300038395 | Bacteria | 4067 |
| 10 | Ga0466690_010693 | 3300042590 | Bacteria | 8227 |
| 11 | Ga0466690_190397 | 3300042590 | Bacteria | 8163 |
| 12 | Ga0466690_351387 | 3300042590 | Unclassified | 1751 |
| 13 | Ga0466692_145733 | 3300042591 | Bacteria | 13724 |
| 14 | Ga0466692_151330 | 3300042591 | Bacteria | 26327 |
| 15 | Ga0466696_168170 | 3300042596 | Bacteria | 14903 |
| 16 | Ga0466696_227354 | 3300042596 | Bacteria | 3814 |
| 17 | Ga0466699_382589 | 3300042597 | Bacteria | 1936 |
| 18 | Ga0466707_016626 | 3300042601 | Bacteria | 4118 |
| 19 | Ga0466719_517917 | 3300042606 | Bacteria | 23969 |
| 20 | Ga0466722_007465 | 3300042609 | Bacteria | 26514 |
| 21 | Ga0466733_005154 | 3300042659 | Bacteria | 7162 |
| 22 | Ga0466711_034353 | 3300042615 | Bacteria | 11825 |
| 23 | Ga0466723_059840 | 3300042618 | Bacteria | 7293 |
| 24 | Ga0466723_150694 | 3300042618 | Bacteria | 1703 |
| 25 | Ga0466723_150825 | 3300042618 | Bacteria | 28092 |
| 26 | Ga0466726_228225 | 3300042619 | Bacteria | 5494 |
| 27 | Ga0466728_100942 | 3300042620 | Bacteria | 2925 |
| 28 | Ga0466729_172170 | 3300042621 | Bacteria | 1456 |
| 29 | Ga0466735_180203 | 3300042624 | Bacteria | 3911 |
| 30 | Ga0466704_609583 | 3300042643 | Unclassified | 6014 |
| 31 | Ga0415639_092694 | 3300038395 | Bacteria | 2106 |
| 32 | Ga0466694_275628 | 3300042594 | Bacteria | 5744 |
| 33 | Ga0466696_082900 | 3300042596 | Bacteria | 49002 |
| 34 | Ga0466696_279844 | 3300042596 | Bacteria | 12900 |
| 35 | Ga0466707_310074 | 3300042601 | Bacteria | 3812 |
| 36 | Ga0466719_158595 | 3300042606 | Bacteria | 1839 |
| 37 | Ga0466722_065813 | 3300042609 | Bacteria | 20228 |
| 38 | Ga0466722_210993 | 3300042609 | Unclassified | 1558 |
| 39 | Ga0466705_455008 | 3300042612 | Bacteria | 8073 |
| 40 | Ga0466711_457189 | 3300042615 | Unclassified | 3122 |
| 41 | Ga0466723_119865 | 3300042618 | Bacteria | 4969 |
| 42 | Ga0466723_286733 | 3300042618 | Bacteria | 5385 |
| 43 | Ga0466728_023166 | 3300042620 | Bacteria | 15136 |
| 44 | Ga0123353_10172994 | 3300010167 | Bacteria | 3426 |
| 45 | Ga0466703_028252 | 3300042636 | Bacteria | 7507 |
| 46 | Ga0466704_325436 | 3300042643 | Bacteria | 20045 |
| 47 | Ga0466709_257354 | 3300042648 | Bacteria | 3081 |
| 48 | Ga0466708_379270 | 3300042652 | Bacteria | 6383 |
| 49 | Ga0466690_124897 | 3300042590 | Bacteria | 2122 |
| 50 | Ga0466692_048711 | 3300042591 | Bacteria | 4387 |
| 51 | Ga0466695_248088 | 3300042595 | Bacteria | 4650 |
| 52 | Ga0466696_171347 | 3300042596 | Bacteria | 1739 |
| 53 | Ga0466699_303296 | 3300042597 | Bacteria | 2290 |
| 54 | Ga0466699_328497 | 3300042597 | Bacteria | 3903 |
| 55 | Ga0466716_234663 | 3300042605 | Bacteria | 14955 |
| 56 | Ga0466719_067920 | 3300042606 | Bacteria | 3036 |
| 57 | Ga0466719_133458 | 3300042606 | Bacteria | 6381 |
| 58 | Ga0466720_108612 | 3300042607 | Bacteria | 122313 |
| 59 | Ga0466720_185669 | 3300042607 | Bacteria | 1453 |
| 60 | Ga0466722_017904 | 3300042609 | Bacteria | 9151 |
| 61 | Ga0466705_111836 | 3300042612 | Bacteria | 12299 |
| 62 | Ga0466715_076216 | 3300042616 | Bacteria | 5367 |
| 63 | Ga0466726_033442 | 3300042619 | Bacteria | 8708 |
| 64 | Ga0466729_188370 | 3300042621 | Bacteria | 2083 |
| 65 | Ga0123353_10560518 | 3300010167 | Bacteria | 1645 |
| 66 | Ga0466703_034386 | 3300042636 | Bacteria | 1444 |
| 67 | Ga0466704_466856 | 3300042643 | Bacteria | 8356 |
| 68 | Ga0466708_083996 | 3300042652 | Bacteria | 14281 |
| 69 | Ga0466708_099906 | 3300042652 | Bacteria | 39915 |
| 70 | Ga0466708_142045 | 3300042652 | Bacteria | 21166 |
| 71 | Ga0466708_177077 | 3300042652 | Bacteria | 4545 |
| 72 | Ga0466727_080249 | 3300042655 | Bacteria | 3503 |
| 73 | Ga0466692_024472 | 3300042591 | Bacteria | 3570 |
| 74 | Ga0466691_002767 | 3300042593 | Unclassified | 2680 |
| 75 | Ga0466691_185837 | 3300042593 | Bacteria | 10481 |
| 76 | Ga0466696_155739 | 3300042596 | Bacteria | 5265 |
| 77 | Ga0466716_193513 | 3300042605 | Bacteria | 13729 |
| 78 | Ga0466722_014668 | 3300042609 | Bacteria | 1813 |
| 79 | Ga0466722_069109 | 3300042609 | Bacteria | 31526 |
| 80 | Ga0466722_073106 | 3300042609 | Bacteria | 11615 |
| 81 | JGI24698J34947_10000402 | 3300002449 | Bacteria | 19694 |
| 82 | Ga0072941_1080677 | 3300005201 | Bacteria | 4624 |
| 83 | Ga0466715_200322 | 3300042616 | Bacteria | 4718 |
| 84 | Ga0466718_001852 | 3300042617 | Bacteria | 2765 |
| 85 | Ga0466723_147912 | 3300042618 | Bacteria | 18502 |
| 86 | Ga0123357_10074935 | 3300009784 | Bacteria | 4474 |
| 87 | Ga0466708_069259 | 3300042652 | Bacteria | 49691 |
| 88 | Ga0466708_227926 | 3300042652 | Bacteria | 7387 |
| 89 | Ga0466691_098698 | 3300042593 | Unclassified | 1679 |
| 90 | Ga0466691_191018 | 3300042593 | Bacteria | 1911 |
| 91 | Ga0466691_195447 | 3300042593 | Bacteria | 18449 |
| 92 | Ga0466720_195792 | 3300042607 | Bacteria | 2406 |
| 93 | Ga0466722_028819 | 3300042609 | Bacteria | 2234 |
| 94 | Ga0466722_168284 | 3300042609 | Bacteria | 10950 |
| 95 | Ga0466711_096348 | 3300042615 | Bacteria | 13113 |
| 96 | Ga0466715_286416 | 3300042616 | Bacteria | 3130 |
| 97 | Ga0466715_376814 | 3300042616 | Bacteria | 6502 |
| 98 | Ga0466715_519280 | 3300042616 | Bacteria | 12079 |
| 99 | Ga0466723_272747 | 3300042618 | Bacteria | 5531 |
| 100 | Ga0466726_084576 | 3300042619 | Bacteria | 2178 |
| 101 | Ga0466728_321099 | 3300042620 | Bacteria | 3467 |
| 102 | Ga0466703_088782 | 3300042636 | Bacteria | 17464 |
| 103 | Ga0466703_211509 | 3300042636 | Bacteria | 5488 |
| 104 | Ga0466703_247709 | 3300042636 | Bacteria | 2416 |
| 105 | Ga0466704_283505 | 3300042643 | Bacteria | 3411 |
| 106 | Ga0466709_091610 | 3300042648 | Bacteria | 4989 |
| 107 | Ga0466709_394333 | 3300042648 | Bacteria | 6049 |
| 108 | Ga0466699_128368 | 3300042597 | Bacteria | 1467 |
| 109 | Ga0466707_193383 | 3300042601 | Bacteria | 2415 |
| 110 | Ga0466719_282348 | 3300042606 | Unclassified | 19679 |
| 111 | Ga0068305_10017930 | 3300005083 | Bacteria | 6468 |
| 112 | Ga0466732_102116 | 3300042656 | Bacteria | 3488 |
| 113 | Ga0466712_227066 | 3300042614 | Bacteria | 3775 |
| 114 | Ga0466711_210375 | 3300042615 | Bacteria | 51464 |
| 115 | Ga0466715_025004 | 3300042616 | Bacteria | 13217 |
| 116 | Ga0466715_058114 | 3300042616 | Bacteria | 12665 |
| 117 | Ga0466715_060943 | 3300042616 | Bacteria | 9404 |
| 118 | Ga0466715_567417 | 3300042616 | Bacteria | 3687 |
| 119 | Ga0466726_036876 | 3300042619 | Bacteria | 3752 |
| 120 | Ga0466726_135832 | 3300042619 | Bacteria | 5080 |
| 121 | Ga0466735_090050 | 3300042624 | Bacteria | 3128 |
| 122 | Ga0466703_013984 | 3300042636 | Bacteria | 1827 |
| 123 | Ga0466708_154773 | 3300042652 | Bacteria | 8497 |
| 124 | Ga0466690_159925 | 3300042590 | Unclassified | 1837 |
| 125 | Ga0466691_070103 | 3300042593 | Bacteria | 31827 |
| 126 | Ga0466691_091661 | 3300042593 | Bacteria | 8865 |
| 127 | Ga0466699_262849 | 3300042597 | Bacteria | 1988 |
| 128 | Ga0466706_138727 | 3300042599 | Bacteria | 2411 |
| 129 | Ga0466707_078647 | 3300042601 | Bacteria | 2987 |
| 130 | Ga0466716_011799 | 3300042605 | Bacteria | 6183 |
| 131 | Ga0466705_105838 | 3300042612 | Bacteria | 8008 |
| 132 | Ga0466705_189089 | 3300042612 | Bacteria | 20276 |
| 133 | Ga0466705_354195 | 3300042612 | Bacteria | 15438 |
| 134 | Ga0466712_188805 | 3300042614 | Bacteria | 13038 |
| 135 | Ga0466711_353856 | 3300042615 | Bacteria | 8505 |
| 136 | Ga0466726_030349 | 3300042619 | Bacteria | 6894 |
| 137 | Ga0466729_142452 | 3300042621 | Bacteria | 2138 |
| 138 | Ga0123353_10502820 | 3300010167 | Bacteria | 1765 |
| 139 | Ga0466704_236569 | 3300042643 | Bacteria | 7867 |
| 140 | Ga0466704_304480 | 3300042643 | Bacteria | 25615 |
| 141 | Ga0466704_472493 | 3300042643 | Bacteria | 20359 |
| 142 | Ga0466708_327203 | 3300042652 | Bacteria | 31501 |
| 143 | Ga0466690_131379 | 3300042590 | Bacteria | 17000 |
| 144 | Ga0466692_178806 | 3300042591 | Bacteria | 32596 |
| 145 | Ga0466691_004320 | 3300042593 | Bacteria | 16520 |
| 146 | Ga0466716_038086 | 3300042605 | Bacteria | 8613 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.