Protein Family IF05870
Metagenome
Isolate
116
Members
35
Samples
115
Scaffolds
302.38
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_169829|Ga0466707_169829_35864_36856
- Length
- 330 aa
- Sequence
- MLYEDLKIRTGWTLSQKIDHAVGTIEAFLAKTDGKGYISFSGGKDSTVLLDIARRFVRRGFPAVFSNTGNEFPEIVQFVRTFDDVTIIRPKMRISDVLSKYGFPLVSKEQSQYIRQARNTNSEILRNIRINGKQGRNGYKQGKIDDKWLFLIKAPFEVSELCCQKLKKDPFHTYSKETGLYPIIGTMASESRLRLQKWLKTGCNSFDSKNIASYPLSIWTENDIWEYIHKLKVPYSPIYDKGCNRTGCMFCGFGCHMEKGLFNRFDVLQNLHPKAYQTFMAYENNGVTYRDALEYIGIKLPDSKNRQLRLFGIDEIINTNKVNSYESNYS
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.0%
Termitidae
34.3%
Rhinotermitidae
8.6%
Termopsidae
8.6%
Unclassified
5.7%
Hodotermitidae
2.9%
Taxonomy
Archaea
0
Bacteria
110
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_035945 | 3300042598 | Bacteria | 53806 |
| 2 | Ga0466706_023631 | 3300042599 | Unclassified | 6525 |
| 3 | Ga0466700_009527 | 3300042600 | Bacteria | 2798 |
| 4 | Ga0466722_233775 | 3300042609 | Bacteria | 26468 |
| 5 | Ga0466715_194966 | 3300042616 | Bacteria | 54056 |
| 6 | Ga0466723_248450 | 3300042618 | Bacteria | 14107 |
| 7 | Ga0466735_222793 | 3300042624 | Bacteria | 8706 |
| 8 | Ga0466704_301219 | 3300042643 | Bacteria | 1455 |
| 9 | Ga0466704_441874 | 3300042643 | Bacteria | 1087 |
| 10 | Ga0466709_007835 | 3300042648 | Bacteria | 2852 |
| 11 | Ga0466709_046018 | 3300042648 | Bacteria | 14812 |
| 12 | Ga0466709_092137 | 3300042648 | Bacteria | 36342 |
| 13 | Ga0466709_217408 | 3300042648 | Bacteria | 7773 |
| 14 | Ga0466708_039641 | 3300042652 | Bacteria | 4470 |
| 15 | Ga0466727_053085 | 3300042655 | Bacteria | 8471 |
| 16 | Ga0466692_021783 | 3300042591 | Bacteria | 16074 |
| 17 | Ga0466692_024350 | 3300042591 | Bacteria | 1520 |
| 18 | Ga0123357_10156219 | 3300009784 | Bacteria | 2750 |
| 19 | JGI24705J35276_12235792 | 3300002504 | Unclassified | 6988 |
| 20 | Ga0466706_045753 | 3300042599 | Bacteria | 7765 |
| 21 | Ga0466706_216392 | 3300042599 | Unclassified | 1022 |
| 22 | Ga0466707_011798 | 3300042601 | Bacteria | 7926 |
| 23 | Ga0466707_169829 | 3300042601 | Bacteria | 57982 |
| 24 | Ga0466711_312376 | 3300042615 | Bacteria | 1595 |
| 25 | Ga0466735_073181 | 3300042624 | Bacteria | 3464 |
| 26 | Ga0466703_059515 | 3300042636 | Bacteria | 1569 |
| 27 | Ga0466704_091339 | 3300042643 | Bacteria | 4047 |
| 28 | Ga0466725_281446 | 3300042654 | Bacteria | 2592 |
| 29 | Ga0466690_077904 | 3300042590 | Bacteria | 3161 |
| 30 | Ga0466691_000475 | 3300042593 | Bacteria | 5559 |
| 31 | Ga0466691_068883 | 3300042593 | Bacteria | 5866 |
| 32 | Ga0466732_104224 | 3300042656 | Bacteria | 1344 |
| 33 | Ga0466701_026681 | 3300042598 | Bacteria | 4742 |
| 34 | Ga0466719_266698 | 3300042606 | Bacteria | 1931 |
| 35 | Ga0466711_234080 | 3300042615 | Bacteria | 1500 |
| 36 | Ga0466711_318427 | 3300042615 | Bacteria | 2039 |
| 37 | Ga0466711_435724 | 3300042615 | Bacteria | 4454 |
| 38 | Ga0466715_245317 | 3300042616 | Bacteria | 4592 |
| 39 | Ga0466728_205464 | 3300042620 | Bacteria | 3783 |
| 40 | Ga0466729_114526 | 3300042621 | Bacteria | 4128 |
| 41 | Ga0466704_176680 | 3300042643 | Bacteria | 2431 |
| 42 | Ga0466690_054006 | 3300042590 | Bacteria | 5803 |
| 43 | Ga0466691_031819 | 3300042593 | Bacteria | 14874 |
| 44 | Ga0466694_135887 | 3300042594 | Bacteria | 1773 |
| 45 | Ga0466696_080985 | 3300042596 | Bacteria | 38621 |
| 46 | Ga0466696_254235 | 3300042596 | Bacteria | 2486 |
| 47 | JGI24705J35276_12235193 | 3300002504 | Bacteria | 6279 |
| 48 | Ga0466706_288803 | 3300042599 | Unclassified | 4878 |
| 49 | Ga0466707_361113 | 3300042601 | Bacteria | 15284 |
| 50 | Ga0466714_077409 | 3300042603 | Bacteria | 5229 |
| 51 | Ga0466722_232080 | 3300042609 | Bacteria | 3520 |
| 52 | Ga0466697_055947 | 3300042611 | Bacteria | 1700 |
| 53 | Ga0466726_291070 | 3300042619 | Bacteria | 2436 |
| 54 | Ga0466729_156054 | 3300042621 | Bacteria | 1328 |
| 55 | Ga0466704_088730 | 3300042643 | Bacteria | 3062 |
| 56 | Ga0466709_232112 | 3300042648 | Bacteria | 7053 |
| 57 | Ga0466709_373998 | 3300042648 | Bacteria | 2106 |
| 58 | Ga0466725_081415 | 3300042654 | Bacteria | 9825 |
| 59 | Ga0466727_048180 | 3300042655 | Bacteria | 6798 |
| 60 | Ga0466692_141713 | 3300042591 | Bacteria | 5059 |
| 61 | Ga0466691_037802 | 3300042593 | Bacteria | 4236 |
| 62 | Ga0466733_034182 | 3300042659 | Bacteria | 3548 |
| 63 | Ga0123354_10105739 | 3300010882 | Bacteria | 3763 |
| 64 | Ga0466711_478838 | 3300042615 | Bacteria | 21927 |
| 65 | Ga0466715_338457 | 3300042616 | Bacteria | 55922 |
| 66 | Ga0466726_079429 | 3300042619 | Bacteria | 4397 |
| 67 | Ga0466728_175926 | 3300042620 | Bacteria | 4409 |
| 68 | Ga0466729_179132 | 3300042621 | Bacteria | 1010 |
| 69 | Ga0466703_113752 | 3300042636 | Bacteria | 45034 |
| 70 | Ga0466704_279105 | 3300042643 | Bacteria | 3024 |
| 71 | Ga0466691_145005 | 3300042593 | Bacteria | 30331 |
| 72 | Ga0466696_357335 | 3300042596 | Bacteria | 1869 |
| 73 | Ga0123353_10173497 | 3300010167 | Bacteria | 3421 |
| 74 | Ga0466706_170392 | 3300042599 | Bacteria | 7961 |
| 75 | Ga0466700_248126 | 3300042600 | Bacteria | 6233 |
| 76 | Ga0466707_097541 | 3300042601 | Bacteria | 26190 |
| 77 | Ga0466714_066137 | 3300042603 | Bacteria | 9808 |
| 78 | Ga0466716_223158 | 3300042605 | Bacteria | 1718 |
| 79 | Ga0466722_215837 | 3300042609 | Bacteria | 4605 |
| 80 | Ga0466711_115529 | 3300042615 | Bacteria | 36582 |
| 81 | Ga0466723_012894 | 3300042618 | Bacteria | 1590 |
| 82 | Ga0466723_211508 | 3300042618 | Bacteria | 4584 |
| 83 | Ga0466728_276244 | 3300042620 | Bacteria | 1216 |
| 84 | Ga0466697_110642 | 3300042611 | Bacteria | 1230 |
| 85 | Ga0466703_027044 | 3300042636 | Bacteria | 17195 |
| 86 | Ga0466690_205080 | 3300042590 | Bacteria | 7935 |
| 87 | Ga0466691_136257 | 3300042593 | Bacteria | 2816 |
| 88 | Ga0466696_486842 | 3300042596 | Unclassified | 4336 |
| 89 | Ga0466706_025741 | 3300042599 | Bacteria | 5260 |
| 90 | Ga0466719_117162 | 3300042606 | Bacteria | 1041 |
| 91 | Ga0466719_209320 | 3300042606 | Bacteria | 5340 |
| 92 | Ga0466722_073140 | 3300042609 | Bacteria | 4008 |
| 93 | Ga0466715_086845 | 3300042616 | Bacteria | 1378 |
| 94 | Ga0466726_277997 | 3300042619 | Bacteria | 3511 |
| 95 | Ga0466726_417779 | 3300042619 | Bacteria | 1395 |
| 96 | Ga0466728_451939 | 3300042620 | Bacteria | 2960 |
| 97 | Ga0466729_032462 | 3300042621 | Bacteria | 4997 |
| 98 | Ga0466705_211978 | 3300042612 | Bacteria | 2675 |
| 99 | Ga0466703_123727 | 3300042636 | Bacteria | 3607 |
| 100 | Ga0466704_088256 | 3300042643 | Bacteria | 4801 |
| 101 | Ga0466709_010010 | 3300042648 | Unclassified | 26753 |
| 102 | Ga0466692_082547 | 3300042591 | Bacteria | 86535 |
| 103 | Ga0466691_192096 | 3300042593 | Bacteria | 11653 |
| 104 | Ga0466696_112142 | 3300042596 | Bacteria | 4283 |
| 105 | Ga0466706_208752 | 3300042599 | Bacteria | 6465 |
| 106 | Ga0466719_481936 | 3300042606 | Bacteria | 6149 |
| 107 | Ga0466711_255917 | 3300042615 | Bacteria | 2225 |
| 108 | Ga0466726_430935 | 3300042619 | Bacteria | 1575 |
| 109 | Ga0466705_314052 | 3300042612 | Bacteria | 4173 |
| 110 | Ga0466735_033752 | 3300042624 | Bacteria | 4497 |
| 111 | Ga0466703_215258 | 3300042636 | Bacteria | 1309 |
| 112 | Ga0466709_210765 | 3300042648 | Bacteria | 5489 |
| 113 | Ga0466709_263249 | 3300042648 | Bacteria | 1732 |
| 114 | Ga0466727_148221 | 3300042655 | Bacteria | 2869 |
| 115 | Ga0466696_145061 | 3300042596 | Bacteria | 28529 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01507 | PAPS_reduct | Phosphoadenosine phosphosulfate reductase family | 38 | 251 | 0.84 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01507 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.