Protein Family IF05846
Metagenome
Isolate
114
Members
39
Samples
113
Scaffolds
172.3
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_140949|Ga0466707_140949_6270_6791
- Length
- 157 aa
- Sequence
- MKDVVLSKYTEDFVRIALEFCVLAEKTGQDERDLFIGNMIKVLPLLYLKVSVIPSITEDFESDLETMLGDENLYLETFHPDIKLSDSPVAVKISEDIADIYQDLGNFIGVFKNGQRETMNDSLAFCIQNFEKYWGQRLVNTLRALHYIKYKDEISEE
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.8%
Kalotermitidae
31.6%
Unclassified
10.5%
Termopsidae
10.5%
Rhinotermitidae
5.3%
Passalidae
5.3%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 12 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 27 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466719_331648 | 3300042606 | Bacteria | 1263 |
| 2 | Ga0466698_228986 | 3300042610 | Unclassified | 1920 |
| 3 | Ga0123357_10014661 | 3300009784 | Bacteria | 10240 |
| 4 | Ga0123353_10389012 | 3300010167 | Bacteria | 2082 |
| 5 | Ga0466690_048635 | 3300042590 | Bacteria | 14569 |
| 6 | Ga0466690_048858 | 3300042590 | Bacteria | 42701 |
| 7 | Ga0466690_193047 | 3300042590 | Bacteria | 18642 |
| 8 | Ga0466696_338154 | 3300042596 | Bacteria | 1630 |
| 9 | Ga0466715_123065 | 3300042616 | Bacteria | 16993 |
| 10 | Ga0466715_583205 | 3300042616 | Bacteria | 24186 |
| 11 | Ga0466709_008379 | 3300042648 | Bacteria | 52460 |
| 12 | Ga0466727_032376 | 3300042655 | Bacteria | 52244 |
| 13 | Ga0466701_020426 | 3300042598 | Bacteria | 14193 |
| 14 | Ga0466700_007963 | 3300042600 | Unclassified | 7287 |
| 15 | Ga0466707_087386 | 3300042601 | Bacteria | 25499 |
| 16 | Ga0466707_106327 | 3300042601 | Bacteria | 15546 |
| 17 | Ga0466707_261326 | 3300042601 | Bacteria | 4883 |
| 18 | Ga0466713_083015 | 3300042602 | Bacteria | 2852 |
| 19 | Ga0466722_062447 | 3300042609 | Bacteria | 3303 |
| 20 | Ga0123357_10025010 | 3300009784 | Bacteria | 8049 |
| 21 | Ga0123357_10052147 | 3300009784 | Bacteria | 5525 |
| 22 | Ga0123356_10612220 | 3300010049 | Bacteria | 1254 |
| 23 | Ga0466691_222548 | 3300042593 | Bacteria | 20111 |
| 24 | Ga0466696_074059 | 3300042596 | Bacteria | 10856 |
| 25 | Ga0466728_360258 | 3300042620 | Bacteria | 5803 |
| 26 | Ga0466735_032656 | 3300042624 | Unclassified | 1122 |
| 27 | Ga0466735_137071 | 3300042624 | Bacteria | 2739 |
| 28 | Ga0466735_172236 | 3300042624 | Bacteria | 4417 |
| 29 | Ga0466703_018083 | 3300042636 | Bacteria | 4847 |
| 30 | Ga0466703_210112 | 3300042636 | Bacteria | 1602 |
| 31 | Ga0466697_261495 | 3300042611 | Bacteria | 1148 |
| 32 | Ga0466705_227396 | 3300042612 | Bacteria | 4130 |
| 33 | 2227555480 | 2225789004 | Bacteria | 2793 |
| 34 | IMNBL1DRAFT_c0000013 | 3300000062 | Bacteria | 180832 |
| 35 | Ga0123357_10002074 | 3300009784 | Bacteria | 22005 |
| 36 | Ga0466716_437183 | 3300042605 | Bacteria | 31064 |
| 37 | Ga0466719_132659 | 3300042606 | Bacteria | 30972 |
| 38 | Ga0466722_201140 | 3300042609 | Bacteria | 3588 |
| 39 | Ga0466697_040325 | 3300042611 | Bacteria | 1794 |
| 40 | Ga0123356_12614243 | 3300010049 | Unclassified | 632 |
| 41 | Ga0466690_255390 | 3300042590 | Bacteria | 4057 |
| 42 | Ga0466691_063480 | 3300042593 | Bacteria | 4791 |
| 43 | Ga0466726_272676 | 3300042619 | Bacteria | 1811 |
| 44 | Ga0466735_020568 | 3300042624 | Bacteria | 2387 |
| 45 | Ga0466704_467659 | 3300042643 | Bacteria | 9671 |
| 46 | JGI24702J35022_10025478 | 3300002462 | Bacteria | 3192 |
| 47 | Ga0466707_111106 | 3300042601 | Bacteria | 10236 |
| 48 | Ga0466707_140949 | 3300042601 | Bacteria | 14284 |
| 49 | Ga0466719_498087 | 3300042606 | Bacteria | 2468 |
| 50 | Ga0466722_182573 | 3300042609 | Bacteria | 1243 |
| 51 | Ga0123357_10333311 | 3300009784 | Bacteria | 1479 |
| 52 | Ga0466696_500621 | 3300042596 | Bacteria | 1438 |
| 53 | Ga0466726_142521 | 3300042619 | Bacteria | 18957 |
| 54 | Ga0466726_482479 | 3300042619 | Bacteria | 1203 |
| 55 | Ga0466735_095767 | 3300042624 | Bacteria | 1230 |
| 56 | Ga0466735_127919 | 3300042624 | Bacteria | 1595 |
| 57 | Ga0466707_101263 | 3300042601 | Bacteria | 6988 |
| 58 | Ga0466707_315729 | 3300042601 | Bacteria | 1163 |
| 59 | Ga0466722_139861 | 3300042609 | Bacteria | 1243 |
| 60 | Ga0123356_10645693 | 3300010049 | Bacteria | 1225 |
| 61 | Ga0123354_10195162 | 3300010882 | Bacteria | 2249 |
| 62 | Ga0466690_183666 | 3300042590 | Bacteria | 8816 |
| 63 | Ga0466693_167640 | 3300042592 | Bacteria | 1191 |
| 64 | Ga0466735_222950 | 3300042624 | Bacteria | 3779 |
| 65 | Ga0466703_040225 | 3300042636 | Bacteria | 28005 |
| 66 | Ga0466703_122933 | 3300042636 | Bacteria | 9570 |
| 67 | Ga0466709_154165 | 3300042648 | Bacteria | 14931 |
| 68 | 2227522695 | 2225789004 | Bacteria | 3309 |
| 69 | 2227634903 | 2225789004 | Unclassified | 2097 |
| 70 | IMNBL1DRAFT_c0001623 | 3300000062 | Bacteria | 16669 |
| 71 | IMNBL1DRAFT_c0003387 | 3300000062 | Bacteria | 10317 |
| 72 | JGI24699J35502_11134054 | 3300002509 | Bacteria | 27118 |
| 73 | Ga0072941_1257258 | 3300005201 | Bacteria | 1590 |
| 74 | Ga0466707_184910 | 3300042601 | Bacteria | 13050 |
| 75 | Ga0466716_116220 | 3300042605 | Bacteria | 4740 |
| 76 | Ga0123357_10020633 | 3300009784 | Bacteria | 8810 |
| 77 | Ga0123353_10075990 | 3300010167 | Bacteria | 5398 |
| 78 | Ga0466711_350857 | 3300042615 | Bacteria | 51542 |
| 79 | Ga0466715_128031 | 3300042616 | Bacteria | 13792 |
| 80 | Ga0466734_149046 | 3300042623 | Bacteria | 1462 |
| 81 | Ga0466735_180215 | 3300042624 | Bacteria | 2648 |
| 82 | 2227228038 | 2225789004 | Bacteria | 7376 |
| 83 | JGI24699J35502_10971947 | 3300002509 | Bacteria | 1239 |
| 84 | JGI24699J35502_11134223 | 3300002509 | Bacteria | 71514 |
| 85 | Ga0068302_10060375 | 3300005071 | Bacteria | 4678 |
| 86 | Ga0123357_10000591 | 3300009784 | Bacteria | 35862 |
| 87 | Ga0466713_155494 | 3300042602 | Bacteria | 1776 |
| 88 | Ga0123356_10008266 | 3300010049 | Bacteria | 10355 |
| 89 | Ga0123354_10032636 | 3300010882 | Bacteria | 8159 |
| 90 | Ga0123354_10393909 | 3300010882 | Bacteria | 1180 |
| 91 | Ga0466693_169878 | 3300042592 | Bacteria | 2886 |
| 92 | Ga0466696_254696 | 3300042596 | Bacteria | 1484 |
| 93 | Ga0466703_012411 | 3300042636 | Bacteria | 4129 |
| 94 | Ga0466703_150695 | 3300042636 | Bacteria | 7729 |
| 95 | IMNBL1DRAFT_c0007451 | 3300000062 | Bacteria | 5753 |
| 96 | Ga0068305_10142665 | 3300005083 | Unclassified | 1656 |
| 97 | Ga0466713_125969 | 3300042602 | Bacteria | 4303 |
| 98 | Ga0466713_131783 | 3300042602 | Bacteria | 6935 |
| 99 | Ga0466717_190482 | 3300042604 | Bacteria | 1797 |
| 100 | Ga0466716_043611 | 3300042605 | Bacteria | 1496 |
| 101 | Ga0123354_10006913 | 3300010882 | Bacteria | 16946 |
| 102 | Ga0466692_023132 | 3300042591 | Bacteria | 4707 |
| 103 | Ga0466692_048751 | 3300042591 | Bacteria | 4805 |
| 104 | Ga0466694_107536 | 3300042594 | Bacteria | 4575 |
| 105 | Ga0466711_011990 | 3300042615 | Bacteria | 6742 |
| 106 | Ga0466711_167538 | 3300042615 | Bacteria | 4614 |
| 107 | Ga0466715_125003 | 3300042616 | Bacteria | 5992 |
| 108 | Ga0466726_295959 | 3300042619 | Bacteria | 9043 |
| 109 | Ga0466735_023510 | 3300042624 | Bacteria | 3667 |
| 110 | Ga0466703_238467 | 3300042636 | Bacteria | 1971 |
| 111 | Ga0466704_062076 | 3300042643 | Bacteria | 6235 |
| 112 | Ga0466704_362206 | 3300042643 | Bacteria | 17907 |
| 113 | Ga0466727_102231 | 3300042655 | Bacteria | 4825 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF16702 | DUF5063 | Domain of unknown function (DUF5063) | 6 | 150 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.