Protein Family IF05833

Metagenome Isolate
127 Members
60 Samples
98 Scaffolds
702.17 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_119075|Ga0466707_119075_2604_4826
Length
740 aa
Sequence
MHRISKPVIKKDHSAKMDGSALYVGDYPQEGVLHGKLIRSPHPRARIVAINLPQLPEGYFSVDRSDVPGLNRVHVVLDDSFAFAEDTVEYVGDPLAMIVGPDEQTAASLAAQTEVVYEQLPAVLDIEEHDTVFFDYNFGHGDPDGAFAEADKVYEEVFTTGYQEQAYLEPQGMIAAYDAGAGVMTVHGSIQCPYYVHGAVSKVTGLPPDRVRIIQDVTGGGFGGKEAYPSFLASQTAIAAYKAGGNPVRVVFGRREDMAFTSKRHPSKCSYKVAVKNGRITAMDIDVIFNSGAFTTLSPVVLQRGIIAAPGVYDVPNLKVHGRAVKTNTVPTGAYRGFGAPQTFFAVELMMEHIARDLGIEPLTFKESHLVMQGDMTSTGGQYHYPVPLPALIEEVDELSDYRRKRAEYSKPQSGRYRRGIGMALWFHGAGFTGSGERDLIKAITAIRKTAEGKVEILASNSDMGQGIKTTFSKIVANELNLPYEDILIGNPDTFNVPDSGPTVASRSLMIVGELLRRAAIRLRETWKDGEEQIIEERYAEPDFLTPFSLEDFTGDAYPTYAWAAAAVEIXXXTLTGTNEIIGAWGSFDVGTPIDLNVATGQMEGGVLQGLGYASMEQMAIDAGGRIRNNSYSDYIIPTSKDVPELKVTMHVEEYPFGPYGAKGAGELPLVGIPAAFISAAEQATGGTGINHIPFTAEDALEILSLQNKERNPVIPGQQRNEGTSHPRPRPGIHKGGALT

📊 Sample Types

Isolate 22.1%
Metagenome 78.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 45.0%
Termitidae 21.7%
Kalotermitidae 20.0%
Termopsidae 6.7%
Blattidae 3.3%
Rhinotermitidae 3.3%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
2 2590828839 Clostridium sp. 1 Isolate Termitidae
3 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
4 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
13 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
16 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
17 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
21 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
25 2820836992 Unclassified Actinobacteria Lab288P4bin32 Isolate Unclassified
26 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
27 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
28 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
29 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
32 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
38 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
39 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
40 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
41 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
47 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
48 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
49 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
50 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
51 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
52 2593339125 Clostridium sp. 5 Isolate Termitidae
53 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
54 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
55 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
56 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
57 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
58 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
59 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
60 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_329631 3300042601 Bacteria 5780
2 Ga0466721_097985 3300042608 Bacteria 27262
3 Ga0466722_232304 3300042609 Bacteria 9261
4 Ga0415639_030426 3300038395 Bacteria 3240
5 Ga0123355_10000767 3300009826 Bacteria 43870
6 Ga0123356_10003486 3300010049 Bacteria 16452
7 Ga0123356_10120335 3300010049 Bacteria 2552
8 Ga0123353_10165265 3300010167 Bacteria 3518
9 Ga0123353_10282127 3300010167 Bacteria 2550
10 JGI24695J34938_10000159 3300002450 Bacteria 62505
11 Ga0466705_260708 3300042612 Bacteria 9239
12 Ga0466704_086500 3300042643 Bacteria 11394
13 Ga0466713_107647 3300042602 Bacteria 24108
14 Ga0466691_125877 3300042593 Bacteria 7015
15 Ga0466711_108937 3300042615 Bacteria 35885
16 Ga0466715_146685 3300042616 Bacteria 3046
17 Ga0123355_10001580 3300009826 Bacteria 31786
18 Ga0123355_10131830 3300009826 Bacteria 3850
19 Ga0123355_10165770 3300009826 Bacteria 3316
20 Ga0123356_10000795 3300010049 Bacteria 35033
21 Ga0123356_10001852 3300010049 Bacteria 22940
22 Ga0123356_10003366 3300010049 Bacteria 16796
23 Ga0123356_10012496 3300010049 Bacteria 8232
24 Ga0123353_10000333 3300010167 Bacteria 58025
25 Ga0123353_10090264 3300010167 Bacteria 4933
26 Ga0123353_10184011 3300010167 Bacteria 3305
27 Ga0123353_10242448 3300010167 Bacteria 2799
28 Ga0068305_10013128 3300005083 Bacteria 20037
29 Ga0466708_171820 3300042652 Bacteria 69370
30 Ga0466715_167809 3300042616 Bacteria 59858
31 Ga0123356_10000446 3300010049 Bacteria 46577
32 Ga0123356_10002865 3300010049 Bacteria 18251
33 Ga0123356_10058304 3300010049 Bacteria 3600
34 Ga0123353_10000058 3300010167 Bacteria 125313
35 Ga0123353_10000060 3300010167 Bacteria 123051
36 Ga0123353_10028246 3300010167 Bacteria 8615
37 Ga0123353_10035941 3300010167 Bacteria 7756
38 Ga0466705_319466 3300042612 Bacteria 27771
39 Ga0466703_004494 3300042636 Bacteria 9433
40 Ga0466708_030628 3300042652 Bacteria 94331
41 Ga0466708_179337 3300042652 Bacteria 29890
42 Ga0466725_320944 3300042654 Bacteria 2598
43 Ga0466707_119075 3300042601 Unclassified 5150
44 Ga0466716_109727 3300042605 Bacteria 9008
45 Ga0466722_012298 3300042609 Bacteria 3637
46 Ga0466722_152903 3300042609 Bacteria 10909
47 Ga0415639_016018 3300038395 Bacteria 8501
48 Ga0123355_10006964 3300009826 Bacteria 16841
49 Ga0123355_10220326 3300009826 Unclassified 2730
50 Ga0123353_10016414 3300010167 Bacteria 10826
51 Ga0123354_10097275 3300010882 Unclassified 4012
52 Ga0466733_043322 3300042659 Bacteria 12025
53 Ga0466735_076343 3300042624 Bacteria 2688
54 Ga0466724_46092 3300042649 Bacteria 6210
55 Ga0466707_081271 3300042601 Bacteria 5768
56 Ga0466722_032277 3300042609 Bacteria 25232
57 Ga0466705_407214 3300042612 Bacteria 20230
58 Ga0466711_239333 3300042615 Bacteria 6401
59 Ga0466726_312280 3300042619 Bacteria 4830
60 Ga0123355_10000054 3300009826 Bacteria 118112
61 Ga0123355_10000143 3300009826 Bacteria 85423
62 Ga0123355_10001406 3300009826 Bacteria 33563
63 Ga0123355_10008119 3300009826 Bacteria 15847
64 Ga0123356_10000327 3300010049 Bacteria 54770
65 Ga0123353_10027115 3300010167 Bacteria 8773
66 Ga0068302_10020637 3300005071 Bacteria 6361
67 Ga0466727_251059 3300042655 Bacteria 3012
68 Ga0466707_376323 3300042601 Bacteria 4857
69 Ga0466722_021828 3300042609 Bacteria 20079
70 Ga0466693_390147 3300042592 Bacteria 2081
71 Ga0466711_071925 3300042615 Bacteria 16152
72 Ga0466728_021292 3300042620 Bacteria 4284
73 Ga0466729_068727 3300042621 Bacteria 27754
74 Ga0123356_10011777 3300010049 Bacteria 8513
75 Ga0123353_10130227 3300010167 Bacteria 4038
76 Ga0123353_10273610 3300010167 Bacteria 2600
77 Ga0466705_023857 3300042612 Bacteria 36957
78 Ga0466705_199486 3300042612 Bacteria 19717
79 Ga0466703_067333 3300042636 Bacteria 23157
80 Ga0466709_337170 3300042648 Bacteria 51271
81 Ga0466725_250254 3300042654 Bacteria 4258
82 Ga0466727_164717 3300042655 Bacteria 3972
83 Ga0466713_043845 3300042602 Bacteria 115614
84 Ga0466721_114097 3300042608 Bacteria 23336
85 Ga0466715_156844 3300042616 Bacteria 19036
86 Ga0466715_406082 3300042616 Bacteria 3821
87 Ga0466729_012315 3300042621 Bacteria 6824
88 Ga0123355_10035971 3300009826 Bacteria 8051
89 Ga0123356_10003751 3300010049 Bacteria 15836
90 Ga0123356_10004947 3300010049 Bacteria 13663
91 Ga0123353_10091019 3300010167 Bacteria 4913
92 Ga0123353_10145828 3300010167 Bacteria 3785
93 Ga0466725_061807 3300042654 Bacteria 2945
94 Ga0466719_212359 3300042606 Bacteria 15889
95 Ga0415639_050570 3300038395 Bacteria 10274
96 Ga0466723_129049 3300042618 Bacteria 10247
97 Ga0123353_10027557 3300010167 Bacteria 8709
98 JGI24695J34938_10000340 3300002450 Bacteria 46153

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02738 MoCoBD_1 Molybdopterin cofactor-binding domain 131 367 0.96
PF20256 MoCoBD_2 Molybdopterin cofactor-binding domain 396 644 0.91
PF01315 Ald_Xan_dh_C Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain 19 121 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02738 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.