Protein Family IF05813
Metagenome
Isolate
148
Members
34
Samples
147
Scaffolds
181.72
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_079730|Ga0466707_079730_262_864
- Length
- 200 aa
- Sequence
- LLRFDLTARQPPRQAEVNMAIVAKKIQDSKVKAIDELKESFGASKDFIFTDYRGLTVEQITNLRKLLRAKETQYKVVKNNFARLAFEQLGAQDVSGYLTGPTAVAIAPKDSNEVAKILFDFIKEAPTLQVKGALVGDSVYTTAQTQAFSKLPGRLELISMLMSVMNGPARNLAAALNDIPSRLVRTIKAVGDKKAGGDAA
Sample Types
Isolate
0.7%
Metagenome
99.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
41.2%
Termitidae
32.4%
Rhinotermitidae
11.8%
Termopsidae
8.8%
Unclassified
5.9%
Taxonomy
Archaea
0
Bacteria
146
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_002536 | 3300042612 | Bacteria | 1362 |
| 2 | Ga0466705_384880 | 3300042612 | Bacteria | 9917 |
| 3 | Ga0466719_182326 | 3300042606 | Bacteria | 8554 |
| 4 | Ga0466723_308183 | 3300042618 | Bacteria | 7502 |
| 5 | Ga0466723_362598 | 3300042618 | Bacteria | 2042 |
| 6 | Ga0466726_316254 | 3300042619 | Bacteria | 24109 |
| 7 | Ga0466726_337555 | 3300042619 | Bacteria | 2890 |
| 8 | Ga0466728_017609 | 3300042620 | Bacteria | 3684 |
| 9 | Ga0466729_133438 | 3300042621 | Bacteria | 1114 |
| 10 | Ga0415639_103943 | 3300038395 | Bacteria | 1294 |
| 11 | Ga0466692_128227 | 3300042591 | Bacteria | 3786 |
| 12 | Ga0466735_052380 | 3300042624 | Bacteria | 1619 |
| 13 | Ga0466735_057603 | 3300042624 | Unclassified | 1767 |
| 14 | Ga0466704_007667 | 3300042643 | Bacteria | 23444 |
| 15 | Ga0466704_168972 | 3300042643 | Bacteria | 3412 |
| 16 | Ga0466704_332579 | 3300042643 | Bacteria | 76527 |
| 17 | Ga0466704_415332 | 3300042643 | Bacteria | 1191 |
| 18 | Ga0466708_243516 | 3300042652 | Bacteria | 3998 |
| 19 | Ga0466707_088324 | 3300042601 | Bacteria | 13666 |
| 20 | Ga0466716_414222 | 3300042605 | Bacteria | 6529 |
| 21 | Ga0466719_373228 | 3300042606 | Bacteria | 5014 |
| 22 | Ga0466711_282118 | 3300042615 | Bacteria | 12293 |
| 23 | Ga0466715_075578 | 3300042616 | Bacteria | 13118 |
| 24 | Ga0466723_049060 | 3300042618 | Bacteria | 10969 |
| 25 | Ga0466723_221915 | 3300042618 | Bacteria | 2256 |
| 26 | Ga0466728_164671 | 3300042620 | Bacteria | 3753 |
| 27 | Ga0466690_216321 | 3300042590 | Bacteria | 12129 |
| 28 | Ga0466696_156531 | 3300042596 | Bacteria | 6876 |
| 29 | Ga0466735_164216 | 3300042624 | Bacteria | 1053 |
| 30 | Ga0466704_133027 | 3300042643 | Bacteria | 4734 |
| 31 | Ga0466704_291003 | 3300042643 | Bacteria | 20080 |
| 32 | Ga0466709_134791 | 3300042648 | Bacteria | 15610 |
| 33 | Ga0466708_011293 | 3300042652 | Bacteria | 8499 |
| 34 | Ga0466708_191843 | 3300042652 | Bacteria | 1279 |
| 35 | Ga0466727_342166 | 3300042655 | Bacteria | 2674 |
| 36 | JGI24698J34947_10133995 | 3300002449 | Unclassified | 1054 |
| 37 | Ga0466705_281419 | 3300042612 | Bacteria | 5940 |
| 38 | Ga0466707_238109 | 3300042601 | Bacteria | 2514 |
| 39 | Ga0466719_157241 | 3300042606 | Bacteria | 1627 |
| 40 | Ga0466719_371283 | 3300042606 | Bacteria | 6314 |
| 41 | Ga0466728_030252 | 3300042620 | Bacteria | 2325 |
| 42 | Ga0466728_162198 | 3300042620 | Bacteria | 1376 |
| 43 | Ga0466728_273107 | 3300042620 | Bacteria | 17416 |
| 44 | Ga0466690_007249 | 3300042590 | Bacteria | 17772 |
| 45 | Ga0466690_014125 | 3300042590 | Bacteria | 3237 |
| 46 | Ga0466690_164024 | 3300042590 | Bacteria | 9904 |
| 47 | Ga0466696_014713 | 3300042596 | Bacteria | 27768 |
| 48 | Ga0466696_137049 | 3300042596 | Bacteria | 2123 |
| 49 | Ga0466696_190385 | 3300042596 | Bacteria | 26854 |
| 50 | Ga0123356_10114685 | 3300010049 | Bacteria | 2609 |
| 51 | Ga0123356_10517966 | 3300010049 | Bacteria | 1350 |
| 52 | Ga0466703_068079 | 3300042636 | Bacteria | 1137 |
| 53 | Ga0466703_141091 | 3300042636 | Bacteria | 1135 |
| 54 | Ga0466704_143217 | 3300042643 | Bacteria | 12752 |
| 55 | Ga0466709_018194 | 3300042648 | Bacteria | 16563 |
| 56 | Ga0466708_112603 | 3300042652 | Bacteria | 18701 |
| 57 | Ga0466708_391152 | 3300042652 | Bacteria | 1123 |
| 58 | Ga0466727_064450 | 3300042655 | Bacteria | 1047 |
| 59 | JGI24695J34938_10114328 | 3300002450 | Bacteria | 1099 |
| 60 | Ga0466705_161332 | 3300042612 | Bacteria | 5481 |
| 61 | Ga0466705_370288 | 3300042612 | Bacteria | 2919 |
| 62 | Ga0466707_079730 | 3300042601 | Bacteria | 1082 |
| 63 | Ga0466707_229055 | 3300042601 | Bacteria | 1101 |
| 64 | Ga0466717_278100 | 3300042604 | Bacteria | 1993 |
| 65 | Ga0466719_256530 | 3300042606 | Bacteria | 17913 |
| 66 | Ga0466712_016399 | 3300042614 | Bacteria | 2738 |
| 67 | Ga0466728_294011 | 3300042620 | Bacteria | 3919 |
| 68 | Ga0466692_086797 | 3300042591 | Bacteria | 8284 |
| 69 | Ga0466692_160245 | 3300042591 | Bacteria | 21379 |
| 70 | Ga0466691_032311 | 3300042593 | Bacteria | 18403 |
| 71 | Ga0466691_038428 | 3300042593 | Bacteria | 2705 |
| 72 | Ga0466694_099132 | 3300042594 | Bacteria | 1574 |
| 73 | Ga0466735_232993 | 3300042624 | Bacteria | 2118 |
| 74 | Ga0466703_005188 | 3300042636 | Bacteria | 12988 |
| 75 | Ga0466703_156606 | 3300042636 | Bacteria | 7268 |
| 76 | Ga0466703_243841 | 3300042636 | Bacteria | 17504 |
| 77 | Ga0466704_170574 | 3300042643 | Bacteria | 1019 |
| 78 | Ga0466704_219919 | 3300042643 | Bacteria | 4836 |
| 79 | Ga0466708_150210 | 3300042652 | Bacteria | 8651 |
| 80 | Ga0466708_162571 | 3300042652 | Bacteria | 8159 |
| 81 | JGI24695J34938_10000605 | 3300002450 | Bacteria | 34496 |
| 82 | Ga0466705_324953 | 3300042612 | Bacteria | 4837 |
| 83 | Ga0466716_075987 | 3300042605 | Bacteria | 5074 |
| 84 | Ga0466722_075873 | 3300042609 | Bacteria | 8205 |
| 85 | Ga0466722_225624 | 3300042609 | Bacteria | 24515 |
| 86 | Ga0466728_006919 | 3300042620 | Bacteria | 20488 |
| 87 | Ga0466728_135397 | 3300042620 | Bacteria | 1193 |
| 88 | Ga0466691_179250 | 3300042593 | Bacteria | 50171 |
| 89 | Ga0466708_071906 | 3300042652 | Bacteria | 6118 |
| 90 | JGI24695J34938_10000099 | 3300002450 | Bacteria | 75735 |
| 91 | Ga0466707_016618 | 3300042601 | Bacteria | 2624 |
| 92 | Ga0466716_065971 | 3300042605 | Bacteria | 8389 |
| 93 | Ga0466719_039575 | 3300042606 | Bacteria | 2978 |
| 94 | Ga0466722_019103 | 3300042609 | Bacteria | 17034 |
| 95 | Ga0466722_173697 | 3300042609 | Bacteria | 4050 |
| 96 | Ga0466722_222988 | 3300042609 | Bacteria | 14186 |
| 97 | Ga0466705_485258 | 3300042612 | Bacteria | 18362 |
| 98 | Ga0466705_505487 | 3300042612 | Bacteria | 1116 |
| 99 | Ga0466691_210932 | 3300042593 | Bacteria | 1818 |
| 100 | Ga0123356_10754840 | 3300010049 | Bacteria | 1143 |
| 101 | Ga0466703_097389 | 3300042636 | Bacteria | 65902 |
| 102 | Ga0466703_338243 | 3300042636 | Bacteria | 38904 |
| 103 | Ga0466704_024143 | 3300042643 | Bacteria | 1174 |
| 104 | Ga0466704_180057 | 3300042643 | Bacteria | 11893 |
| 105 | Ga0466704_222635 | 3300042643 | Bacteria | 2260 |
| 106 | Ga0466708_080408 | 3300042652 | Bacteria | 2971 |
| 107 | Ga0466711_325408 | 3300042615 | Bacteria | 8662 |
| 108 | Ga0466711_390379 | 3300042615 | Bacteria | 8740 |
| 109 | Ga0466718_095281 | 3300042617 | Bacteria | 1929 |
| 110 | Ga0466723_209184 | 3300042618 | Bacteria | 3893 |
| 111 | Ga0466726_185471 | 3300042619 | Bacteria | 1144 |
| 112 | Ga0466726_227136 | 3300042619 | Bacteria | 2687 |
| 113 | Ga0466728_438421 | 3300042620 | Bacteria | 2072 |
| 114 | Ga0466690_206243 | 3300042590 | Bacteria | 1900 |
| 115 | Ga0466691_098562 | 3300042593 | Bacteria | 11503 |
| 116 | Ga0466691_171775 | 3300042593 | Bacteria | 14094 |
| 117 | Ga0466696_088095 | 3300042596 | Bacteria | 3510 |
| 118 | Ga0123353_11446801 | 3300010167 | Bacteria | 880 |
| 119 | Ga0466729_275132 | 3300042621 | Bacteria | 1621 |
| 120 | Ga0466735_010594 | 3300042624 | Bacteria | 17619 |
| 121 | Ga0466703_168917 | 3300042636 | Bacteria | 27431 |
| 122 | Ga0466704_170620 | 3300042643 | Bacteria | 49858 |
| 123 | Ga0466716_114616 | 3300042605 | Bacteria | 3910 |
| 124 | Ga0466716_126719 | 3300042605 | Bacteria | 19335 |
| 125 | Ga0466716_284223 | 3300042605 | Bacteria | 20573 |
| 126 | Ga0466719_460780 | 3300042606 | Bacteria | 37540 |
| 127 | Ga0466711_059292 | 3300042615 | Bacteria | 12030 |
| 128 | Ga0466711_233155 | 3300042615 | Bacteria | 2246 |
| 129 | Ga0466723_157835 | 3300042618 | Bacteria | 20243 |
| 130 | Ga0466726_471977 | 3300042619 | Bacteria | 1789 |
| 131 | Ga0466728_235616 | 3300042620 | Bacteria | 1953 |
| 132 | Ga0456237_0001411 | 3300041968 | Bacteria | 3827 |
| 133 | Ga0466690_297715 | 3300042590 | Bacteria | 17272 |
| 134 | Ga0466690_423654 | 3300042590 | Bacteria | 5745 |
| 135 | Ga0466692_082160 | 3300042591 | Bacteria | 31423 |
| 136 | Ga0466693_236433 | 3300042592 | Bacteria | 8743 |
| 137 | Ga0466691_109349 | 3300042593 | Bacteria | 1204 |
| 138 | Ga0466691_128423 | 3300042593 | Bacteria | 7008 |
| 139 | Ga0123356_10893287 | 3300010049 | Bacteria | 1060 |
| 140 | Ga0466735_018405 | 3300042624 | Bacteria | 3646 |
| 141 | Ga0466735_070012 | 3300042624 | Bacteria | 1486 |
| 142 | Ga0466730_100096 | 3300042625 | Bacteria | 2034 |
| 143 | Ga0466703_049534 | 3300042636 | Bacteria | 1878 |
| 144 | Ga0466703_144875 | 3300042636 | Bacteria | 6305 |
| 145 | Ga0466703_299809 | 3300042636 | Bacteria | 8756 |
| 146 | Ga0466704_391832 | 3300042643 | Bacteria | 4866 |
| 147 | Ga0466727_241173 | 3300042655 | Bacteria | 1885 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00466 | Ribosomal_L10 | Ribosomal protein L10 | 27 | 122 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.