Protein Family IF05722

Metagenome Isolate
136 Members
52 Samples
128 Scaffolds
254.97 Avg Length

🧬 Representative Sequence

ID
3300042600|Ga0466700_144373|Ga0466700_144373_566_1405
Length
279 aa
Sequence
MVMVQDCIGQGFFLERQKGKLMPYKHGRPVIDLSPWFRIASAWTFLLLIIPIAWLFNFMQHGTRYKHRWRMYGIRRAITVSNHTTFLDPVKISVLVLPRLIYQTLLEATVEFPFLGTFTRLLGGVPIPMGRAGYKKILEICDKAFKYRRYIHFYPEGECFLYSQHIGEFHTGAFKIAAELDIPIVPLVTVFSNGFLGNRGIFKPRSFWGRSLPVETLVVLEPVYPAHYIRRDSKGEITIRSIREFTEAVRQKMQQEIDRRNGSNAFFRGKMERIKGLND

📊 Sample Types

Isolate 5.9%
Metagenome 94.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.0%
Kalotermitidae 28.0%
Unclassified 16.0%
Rhinotermitidae 6.0%
Termopsidae 6.0%

🌳 Taxonomy

Archaea 2
Bacteria 120
Eukaryota 0
Viruses 1
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
2 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
27 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
28 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
29 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
34 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
35 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
36 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
37 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
38 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
41 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
42 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
45 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
46 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
52 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466719_104197 3300042606 Bacteria 30611
2 Ga0466720_026656 3300042607 Bacteria 7969
3 Ga0466720_085121 3300042607 Bacteria 6634
4 Ga0466692_149073 3300042591 Bacteria 4170
5 Ga0466699_132504 3300042597 Bacteria 2287
6 Ga0466699_161983 3300042597 Bacteria 13467
7 Ga0466699_169854 3300042597 Bacteria 9635
8 Ga0466701_010999 3300042598 Unclassified 2430
9 JGI24695J34938_10000132 3300002450 Bacteria 67814
10 JGI24695J34938_10024336 3300002450 Bacteria 2908
11 Ga0072940_1003601 3300005200 Bacteria 22114
12 Ga0072940_1017262 3300005200 Bacteria 7416
13 Ga0072941_1002912 3300005201 Bacteria 12432
14 Ga0072941_1022204 3300005201 Bacteria 10965
15 Ga0072941_1065500 3300005201 Archaea 9865
16 Ga0466732_331204 3300042656 Unclassified 1436
17 Ga0466722_183338 3300042609 Bacteria 3278
18 Ga0466698_413509 3300042610 Bacteria 3243
19 Ga0466702_464647 3300042635 Bacteria 7935
20 Ga0466709_239544 3300042648 Bacteria 1379
21 Ga0264413_103330 3300024493 Bacteria 6763
22 Ga0466696_263273 3300042596 Bacteria 3255
23 Ga0466699_111430 3300042597 Bacteria 3446
24 Ga0466712_159386 3300042614 Unclassified 4186
25 Ga0466711_052757 3300042615 Bacteria 13222
26 Ga0466711_155412 3300042615 Bacteria 10135
27 Ga0466715_577176 3300042616 Bacteria 7547
28 Ga0466715_598907 3300042616 Bacteria 2318
29 AustNasuHG_c1000323 3300000089 Bacteria 16596
30 JGI24698J34947_10091434 3300002449 Unclassified 1395
31 JGI24695J34938_10000586 3300002450 Bacteria 35159
32 Ga0466732_077520 3300042656 Unclassified 1623
33 Ga0466732_318295 3300042656 Bacteria 1915
34 Ga0466717_241951 3300042604 Bacteria 1353
35 Ga0466716_087643 3300042605 Bacteria 24320
36 Ga0466720_038815 3300042607 Bacteria 10179
37 Ga0466698_445428 3300042610 Unclassified 1968
38 Ga0466698_486601 3300042610 Bacteria 1132
39 Ga0466735_050880 3300042624 Bacteria 2596
40 Ga0466708_090688 3300042652 Bacteria 3067
41 Ga0123356_10069451 3300010049 Bacteria 3304
42 Ga0466712_201063 3300042614 Unclassified 1940
43 Ga0466711_013964 3300042615 Bacteria 2134
44 Ga0466718_045807 3300042617 Bacteria 1850
45 Ga0466726_325755 3300042619 Bacteria 3658
46 Ga0466728_069868 3300042620 Bacteria 1842
47 JGI24698J34947_10016010 3300002449 Bacteria 4077
48 JGI24695J34938_10000640 3300002450 Bacteria 33416
49 JGI24700J35501_10923034 3300002508 Bacteria 5074
50 Ga0466700_144373 3300042600 Bacteria 1740
51 Ga0466720_017925 3300042607 Bacteria 11697
52 Ga0466722_111218 3300042609 Bacteria 4177
53 Ga0466727_260941 3300042655 Bacteria 1969
54 Ga0264413_119961 3300024493 Bacteria 4176
55 Ga0466711_236407 3300042615 Bacteria 3673
56 JGI24698J34947_10003956 3300002449 Bacteria 8060
57 JGI24698J34947_10011741 3300002449 Bacteria 4810
58 JGI24695J34938_10008089 3300002450 Bacteria 6054
59 JGI24695J34938_10024566 3300002450 Bacteria 2892
60 Ga0072941_1071650 3300005201 Bacteria 5372
61 Ga0466705_249636 3300042612 Bacteria 42301
62 Ga0466732_002559 3300042656 Bacteria 3014
63 Ga0466722_049613 3300042609 Bacteria 3495
64 Ga0466703_222945 3300042636 Bacteria 19313
65 Ga0466709_395365 3300042648 Bacteria 14172
66 Ga0466709_414702 3300042648 Bacteria 3845
67 Ga0466708_144254 3300042652 Bacteria 3306
68 Ga0466727_340717 3300042655 Bacteria 2176
69 Ga0456237_0002022 3300041968 Unclassified 3276
70 Ga0466690_118658 3300042590 Bacteria 5585
71 Ga0466691_025777 3300042593 Bacteria 3036
72 Ga0466695_259092 3300042595 Bacteria 134193
73 Ga0466699_280968 3300042597 Bacteria 14109
74 Ga0123353_10704961 3300010167 Bacteria 1416
75 JGI24698J34947_10026662 3300002449 Bacteria 3070
76 JGI24695J34938_10003208 3300002450 Bacteria 11588
77 JGI24695J34938_10004695 3300002450 Bacteria 8855
78 JGI24702J35022_10024487 3300002462 Bacteria 3261
79 Ga0466700_416386 3300042600 Bacteria 1030
80 Ga0466717_214962 3300042604 Bacteria 1244
81 Ga0466720_051363 3300042607 Bacteria 6093
82 Ga0466720_162780 3300042607 Bacteria 14596
83 Ga0466703_152035 3300042636 Bacteria 10357
84 Ga0466704_101043 3300042643 Bacteria 55879
85 Ga0466708_036794 3300042652 Bacteria 6881
86 Ga0466708_211352 3300042652 Bacteria 3390
87 Ga0466727_161097 3300042655 Bacteria 3579
88 Ga0415639_034039 3300038395 Bacteria 5768
89 Ga0466692_003668 3300042591 Bacteria 7165
90 Ga0466699_051898 3300042597 Bacteria 29918
91 Ga0466712_043739 3300042614 Bacteria 8092
92 Ga0466711_183350 3300042615 Bacteria 47393
93 Ga0466723_009040 3300042618 Bacteria 2989
94 JGI24698J34947_10007308 3300002449 Bacteria 6070
95 JGI24698J34947_10016868 3300002449 Bacteria 3962
96 JGI24695J34938_10050091 3300002450 Bacteria 1833
97 JGI24702J35022_10055407 3300002462 Unclassified 2115
98 Ga0466720_103827 3300042607 Bacteria 28288
99 Ga0466720_167237 3300042607 Bacteria 43895
100 Ga0264413_100256 3300024493 Bacteria 6128
101 Ga0264413_100697 3300024493 Bacteria 9944
102 Ga0466690_121507 3300042590 Unclassified 2652
103 Ga0466694_372592 3300042594 Bacteria 1320
104 Ga0466699_245993 3300042597 Bacteria 2218
105 Ga0466699_307954 3300042597 Bacteria 13307
106 Ga0123354_10118484 3300010882 Bacteria 3438
107 Ga0466718_011237 3300042617 Bacteria 1317
108 JGI24698J34947_10001435 3300002449 Bacteria 12537
109 JGI24698J34947_10051534 3300002449 Bacteria 2069
110 JGI24695J34938_10017395 3300002450 Bacteria 3622
111 Ga0072941_1000677 3300005201 Viruses 3103
112 Ga0072941_1022205 3300005201 Bacteria 1075
113 Ga0466705_031510 3300042612 Bacteria 1498
114 Ga0466722_048546 3300042609 Bacteria 18150
115 Ga0466722_049674 3300042609 Bacteria 7834
116 Ga0466735_153004 3300042624 Bacteria 1809
117 Ga0466708_031299 3300042652 Bacteria 8597
118 Ga0466708_264725 3300042652 Unclassified 1217
119 Ga0466696_448557 3300042596 Archaea 1429
120 Ga0466699_137803 3300042597 Bacteria 13206
121 Ga0123356_10006220 3300010049 Bacteria 12066
122 Ga0123354_10299327 3300010882 Unclassified 1525
123 Ga0466712_111168 3300042614 Bacteria 1611
124 Ga0466712_284884 3300042614 Unclassified 1012
125 Ga0466718_062519 3300042617 Bacteria 1419
126 Ga0466728_151650 3300042620 Bacteria 3657
127 JGI24698J34947_10010707 3300002449 Bacteria 5034
128 Ga0072941_1033017 3300005201 Bacteria 2025

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042656 Ga0466732_077520 Ga0466732_077520_436_1098 220
2 3300042614 Ga0466712_284884 Ga0466712_284884_144_812 222
3 3300042598 Ga0466701_010999 Ga0466701_010999_514_1194 226
4 3300042635 Ga0466702_464647 Ga0466702_464647_3162_3842 226
5 3300042656 Ga0466732_331204 Ga0466732_331204_556_1236 226
6 3300010882 Ga0123354_10299327 Ga0123354_102993271 231
7 3300010882 Ga0123354_10118484 Ga0123354_101184843 232
8 3300042652 Ga0466708_264725 Ga0466708_264725_274_972 232
9 3300042652 Ga0466708_090688 Ga0466708_090688_57_758 233
10 3300042610 Ga0466698_445428 Ga0466698_445428_346_1050 234
11 3300042615 Ga0466711_013964 Ga0466711_013964_239_943 234
12 3300042597 Ga0466699_245993 Ga0466699_245993_660_1394 244
13 3300038395 Ga0415639_034039 Ga0415639_034039_451_1194 247
14 3300042652 Ga0466708_144254 Ga0466708_144254_122_865 247
15 3300042616 Ga0466715_577176 Ga0466715_577176_4279_5031 250
16 3300024493 Ga0264413_100697 Ga0264413_10069711 251
17 3300024493 Ga0264413_119961 Ga0264413_1199615 251
18 3300042594 Ga0466694_372592 Ga0466694_372592_201_956 251
19 3300042595 Ga0466695_259092 Ga0466695_259092_28661_29416 251
20 3300042597 Ga0466699_111430 Ga0466699_111430_2644_3399 251
21 3300042597 Ga0466699_161983 Ga0466699_161983_12361_13116 251
22 3300042597 Ga0466699_280968 Ga0466699_280968_12404_13159 251
23 3300042604 Ga0466717_214962 Ga0466717_214962_426_1181 251
24 3300042605 Ga0466716_087643 Ga0466716_087643_22406_23161 251
25 3300042606 Ga0466719_104197 Ga0466719_104197_5075_5830 251
26 3300042607 Ga0466720_038815 Ga0466720_038815_6888_7643 251
27 3300042607 Ga0466720_103827 Ga0466720_103827_19680_20435 251
28 3300042607 Ga0466720_162780 Ga0466720_162780_7430_8185 251
29 3300042612 Ga0466705_031510 Ga0466705_031510_524_1279 251
30 3300042612 Ga0466705_249636 Ga0466705_249636_38026_38781 251
31 3300042614 Ga0466712_043739 Ga0466712_043739_3091_3846 251
32 3300042615 Ga0466711_052757 Ga0466711_052757_12089_12844 251
33 3300042615 Ga0466711_155412 Ga0466711_155412_3324_4079 251
34 3300042615 Ga0466711_183350 Ga0466711_183350_30486_31241 251
35 3300042617 Ga0466718_011237 Ga0466718_011237_461_1216 251
36 3300042619 Ga0466726_325755 Ga0466726_325755_2402_3157 251
37 3300042624 Ga0466735_050880 Ga0466735_050880_1194_1949 251
38 3300042643 Ga0466704_101043 Ga0466704_101043_49357_50112 251
39 3300042655 Ga0466727_260941 Ga0466727_260941_968_1723 251
40 3300042655 Ga0466727_340717 Ga0466727_340717_236_991 251
41 3300042656 Ga0466732_318295 Ga0466732_318295_324_1079 251
42 iso_pr_bacteria 2781125683 2781410917 251
43 iso_pr_bacteria 2781125688 2781424279 251
44 iso_pr_bacteria 2781125696 2781441694 251
45 3300000089 AustNasuHG_c1000323 AustNasuHG_100032315 252
46 3300002449 JGI24698J34947_10003956 JGI24698J34947_100039565 252
47 3300002449 JGI24698J34947_10007308 JGI24698J34947_100073086 252
48 3300002449 JGI24698J34947_10010707 JGI24698J34947_100107072 252
49 3300002449 JGI24698J34947_10011741 JGI24698J34947_100117413 252
50 3300002449 JGI24698J34947_10016868 JGI24698J34947_100168682 252
51 3300002449 JGI24698J34947_10091434 JGI24698J34947_100914342 252
52 3300002450 JGI24695J34938_10000132 JGI24695J34938_1000013240 252
53 3300002450 JGI24695J34938_10000586 JGI24695J34938_100005867 252
54 3300002450 JGI24695J34938_10000640 JGI24695J34938_100006407 252
55 3300002450 JGI24695J34938_10004695 JGI24695J34938_100046952 252
56 3300002450 JGI24695J34938_10050091 JGI24695J34938_100500912 252
57 3300002462 JGI24702J35022_10024487 JGI24702J35022_100244872 252
58 3300002462 JGI24702J35022_10055407 JGI24702J35022_100554072 252
59 3300005200 Ga0072940_1003601 Ga0072940_100360114 252
60 3300005200 Ga0072940_1017262 Ga0072940_10172626 252
61 3300005201 Ga0072941_1000677 Ga0072941_10006772 252
62 3300005201 Ga0072941_1033017 Ga0072941_10330172 252
63 3300010049 Ga0123356_10006220 Ga0123356_100062208 252
64 3300010049 Ga0123356_10069451 Ga0123356_100694513 252
65 3300042590 Ga0466690_118658 Ga0466690_118658_3459_4217 252
66 3300042590 Ga0466690_121507 Ga0466690_121507_1113_1871 252
67 3300042593 Ga0466691_025777 Ga0466691_025777_1881_2639 252
68 3300042596 Ga0466696_263273 Ga0466696_263273_192_950 252
69 3300042596 Ga0466696_448557 Ga0466696_448557_454_1212 252
70 3300042616 Ga0466715_598907 Ga0466715_598907_1102_1860 252
71 3300042620 Ga0466728_069868 Ga0466728_069868_416_1174 252
72 3300042636 Ga0466703_152035 Ga0466703_152035_2601_3359 252
73 3300042636 Ga0466703_222945 Ga0466703_222945_13615_14373 252
74 3300042648 Ga0466709_239544 Ga0466709_239544_196_954 252
75 3300042648 Ga0466709_395365 Ga0466709_395365_11708_12466 252
76 3300042648 Ga0466709_414702 Ga0466709_414702_2509_3267 252
77 3300042652 Ga0466708_031299 Ga0466708_031299_4598_5356 252
78 iso_pr_bacteria 2781125640 2781287746 252
79 iso_pr_bacteria 2781125641 2781290109 252
80 iso_pr_bacteria 2819994798 2819995226 252
81 3300002449 JGI24698J34947_10001435 JGI24698J34947_100014354 253
82 3300002450 JGI24695J34938_10003208 JGI24695J34938_100032083 253
83 3300002450 JGI24695J34938_10008089 JGI24695J34938_100080892 253
84 3300002450 JGI24695J34938_10017395 JGI24695J34938_100173954 253
85 3300002450 JGI24695J34938_10024336 JGI24695J34938_100243362 253
86 3300002450 JGI24695J34938_10024566 JGI24695J34938_100245662 253
87 3300002508 JGI24700J35501_10923034 JGI24700J35501_109230342 253
88 3300005201 Ga0072941_1002912 Ga0072941_100291210 253
89 3300042597 Ga0466699_137803 Ga0466699_137803_12355_13116 253
90 3300042609 Ga0466722_183338 Ga0466722_183338_486_1247 253
91 3300042617 Ga0466718_045807 Ga0466718_045807_75_866 253
92 3300042609 Ga0466722_049613 Ga0466722_049613_2489_3253 254
93 3300042609 Ga0466722_049674 Ga0466722_049674_6828_7592 254
94 3300042656 Ga0466732_002559 Ga0466732_002559_653_1486 254
95 3300005201 Ga0072941_1022204 Ga0072941_10222046 256
96 3300005201 Ga0072941_1022205 Ga0072941_10222052 256
97 3300042652 Ga0466708_036794 Ga0466708_036794_3709_4479 256
98 3300042652 Ga0466708_211352 Ga0466708_211352_214_984 256
99 3300042655 Ga0466727_161097 Ga0466727_161097_2004_2774 256
100 3300024493 Ga0264413_100256 Ga0264413_1002562 257
101 3300042617 Ga0466718_062519 Ga0466718_062519_595_1368 257
102 3300005201 Ga0072941_1071650 Ga0072941_10716503 258
103 3300042614 Ga0466712_201063 Ga0466712_201063_1080_1856 258
104 iso_pr_bacteria 2781125682 2781409020 258
105 3300010167 Ga0123353_10704961 Ga0123353_107049612 259
106 3300042607 Ga0466720_167237 Ga0466720_167237_41176_41955 259
107 3300042610 Ga0466698_486601 Ga0466698_486601_26_805 259
108 3300002449 JGI24698J34947_10051534 JGI24698J34947_100515342 260
109 3300042614 Ga0466712_159386 Ga0466712_159386_2755_3537 260
110 3300002449 JGI24698J34947_10026662 JGI24698J34947_100266622 261
111 3300042597 Ga0466699_132504 Ga0466699_132504_86_871 261
112 3300041968 Ga0456237_0002022 Ga0456237_0002022_2384_3172 262
113 iso_pr_bacteria 2781125631 2781267740 262
114 3300042609 Ga0466722_048546 Ga0466722_048546_13688_14479 263
115 3300042591 Ga0466692_003668 Ga0466692_003668_4576_5373 265
116 3300024493 Ga0264413_103330 Ga0264413_1033304 270
117 3300042591 Ga0466692_149073 Ga0466692_149073_1415_2227 270
118 3300042597 Ga0466699_169854 Ga0466699_169854_725_1537 270
119 3300042607 Ga0466720_017925 Ga0466720_017925_5510_6322 270
120 3300042607 Ga0466720_026656 Ga0466720_026656_1792_2604 270
121 3300042607 Ga0466720_051363 Ga0466720_051363_2350_3162 270
122 3300042607 Ga0466720_085121 Ga0466720_085121_685_1497 270
123 3300002449 JGI24698J34947_10016010 JGI24698J34947_100160103 271
124 3300042609 Ga0466722_111218 Ga0466722_111218_955_1770 271
125 3300042597 Ga0466699_307954 Ga0466699_307954_508_1326 272
126 3300042610 Ga0466698_413509 Ga0466698_413509_234_1052 272
127 3300042624 Ga0466735_153004 Ga0466735_153004_260_1078 272
128 3300042615 Ga0466711_236407 Ga0466711_236407_878_1699 273
129 3300042618 Ga0466723_009040 Ga0466723_009040_120_941 273
130 3300042620 Ga0466728_151650 Ga0466728_151650_1088_1909 273
131 3300042600 Ga0466700_416386 Ga0466700_416386_177_1010 277
132 3300042600 Ga0466700_144373 Ga0466700_144373_566_1405 279
133 3300042614 Ga0466712_111168 Ga0466712_111168_286_1134 282
134 3300042597 Ga0466699_051898 Ga0466699_051898_468_1325 285
135 3300042604 Ga0466717_241951 Ga0466717_241951_344_1282 312
136 3300005201 Ga0072941_1065500 Ga0072941_10655003 335

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01553 Acyltransferase Acyltransferase 75 188 0.91

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01553 GO:0016746 acyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.