Protein Family IF05716
Metagenome
Isolate
144
Members
45
Samples
140
Scaffolds
142.19
Avg Length
Representative Sequence
- ID
- 3300042600|Ga0466700_120217|Ga0466700_120217_482_961
- Length
- 159 aa
- Sequence
- MADREISKMKVLVDTNVVIDVLLKQTHFYKDSFAVFKLSDSGHICGVVAAISMTNAFFILRKAGKSSVEVYQDLDDISNIFKVAPLTESTIANALALRWKDFEDAVQFISAKESKVDFIITRNKADYKTSDIPCMTPTEFIAFLKEKEDAAENDNSPRQ
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.6%
Kalotermitidae
26.2%
Unclassified
16.7%
Termopsidae
7.1%
Rhinotermitidae
2.4%
Taxonomy
Archaea
1
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 10 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_370594 | 3300042612 | Bacteria | 1044 |
| 2 | Ga0466732_255003 | 3300042656 | Archaea | 12212 |
| 3 | Ga0123356_10000685 | 3300010049 | Bacteria | 37562 |
| 4 | Ga0123354_10511311 | 3300010882 | Bacteria | 929 |
| 5 | Ga0466713_003574 | 3300042602 | Bacteria | 1212 |
| 6 | Ga0466698_276822 | 3300042610 | Bacteria | 1042 |
| 7 | Ga0466734_047401 | 3300042623 | Bacteria | 2470 |
| 8 | Ga0264413_134788 | 3300024493 | Bacteria | 1600 |
| 9 | Ga0264413_135991 | 3300024493 | Bacteria | 1067 |
| 10 | Ga0466690_067568 | 3300042590 | Bacteria | 1118 |
| 11 | Ga0466694_040002 | 3300042594 | Bacteria | 3510 |
| 12 | Ga0466699_305589 | 3300042597 | Bacteria | 1265 |
| 13 | AustNasuHG_c1001367 | 3300000089 | Bacteria | 8740 |
| 14 | AustNasuHG_c1033593 | 3300000089 | Bacteria | 1392 |
| 15 | JGI24698J34947_10045068 | 3300002449 | Bacteria | 2253 |
| 16 | Ga0466712_286238 | 3300042614 | Bacteria | 1185 |
| 17 | Ga0466715_524248 | 3300042616 | Bacteria | 1250 |
| 18 | Ga0466705_139329 | 3300042612 | Bacteria | 1674 |
| 19 | Ga0123356_10355953 | 3300010049 | Bacteria | 1589 |
| 20 | Ga0466707_042175 | 3300042601 | Bacteria | 1813 |
| 21 | Ga0466707_155503 | 3300042601 | Bacteria | 1363 |
| 22 | Ga0466707_181166 | 3300042601 | Bacteria | 1090 |
| 23 | Ga0466713_133289 | 3300042602 | Bacteria | 1085 |
| 24 | Ga0466720_094823 | 3300042607 | Bacteria | 1203 |
| 25 | Ga0466722_022908 | 3300042609 | Bacteria | 2075 |
| 26 | Ga0466702_040859 | 3300042635 | Bacteria | 9825 |
| 27 | Ga0466702_218245 | 3300042635 | Bacteria | 1203 |
| 28 | Ga0466704_351914 | 3300042643 | Bacteria | 1291 |
| 29 | Ga0466704_507724 | 3300042643 | Bacteria | 2524 |
| 30 | Ga0264413_100969 | 3300024493 | Bacteria | 35384 |
| 31 | JGI24698J34947_10105159 | 3300002449 | Bacteria | 1259 |
| 32 | JGI24705J35276_12215314 | 3300002504 | Bacteria | 1997 |
| 33 | Ga0072941_1069508 | 3300005201 | Bacteria | 4612 |
| 34 | Ga0466712_013111 | 3300042614 | Bacteria | 1583 |
| 35 | Ga0466712_202696 | 3300042614 | Bacteria | 6766 |
| 36 | Ga0466712_305858 | 3300042614 | Bacteria | 1009 |
| 37 | Ga0466718_154523 | 3300042617 | Bacteria | 2048 |
| 38 | Ga0123357_10148807 | 3300009784 | Bacteria | 2849 |
| 39 | Ga0123356_14089414 | 3300010049 | Bacteria | 502 |
| 40 | Ga0123353_10212634 | 3300010167 | Bacteria | 3032 |
| 41 | Ga0466700_256492 | 3300042600 | Bacteria | 1440 |
| 42 | Ga0466700_367729 | 3300042600 | Bacteria | 1711 |
| 43 | Ga0466716_380620 | 3300042605 | Bacteria | 1868 |
| 44 | Ga0466719_359194 | 3300042606 | Bacteria | 1498 |
| 45 | Ga0466722_180981 | 3300042609 | Bacteria | 1054 |
| 46 | Ga0466704_031095 | 3300042643 | Bacteria | 2011 |
| 47 | Ga0466727_210499 | 3300042655 | Bacteria | 1689 |
| 48 | Ga0264413_121409 | 3300024493 | Bacteria | 7133 |
| 49 | Ga0466690_278312 | 3300042590 | Bacteria | 1166 |
| 50 | Ga0466690_279282 | 3300042590 | Bacteria | 1696 |
| 51 | Ga0466699_011964 | 3300042597 | Bacteria | 2186 |
| 52 | JGI24698J34947_10010306 | 3300002449 | Bacteria | 5125 |
| 53 | JGI24698J34947_10024235 | 3300002449 | Bacteria | 3242 |
| 54 | JGI24698J34947_10040228 | 3300002449 | Bacteria | 2415 |
| 55 | JGI24698J34947_10078571 | 3300002449 | Bacteria | 1556 |
| 56 | JGI24698J34947_10090350 | 3300002449 | Bacteria | 1407 |
| 57 | JGI24698J34947_10221111 | 3300002449 | Bacteria | 726 |
| 58 | JGI24705J35276_12216233 | 3300002504 | Bacteria | 2038 |
| 59 | Ga0068305_10934399 | 3300005083 | Bacteria | 598 |
| 60 | Ga0466712_234398 | 3300042614 | Bacteria | 23834 |
| 61 | Ga0466728_075834 | 3300042620 | Bacteria | 5447 |
| 62 | Ga0466700_120217 | 3300042600 | Bacteria | 1104 |
| 63 | Ga0466707_405562 | 3300042601 | Bacteria | 1034 |
| 64 | Ga0466722_096558 | 3300042609 | Bacteria | 11108 |
| 65 | Ga0466704_172445 | 3300042643 | Bacteria | 3236 |
| 66 | Ga0466708_396062 | 3300042652 | Bacteria | 4219 |
| 67 | Ga0466699_042530 | 3300042597 | Bacteria | 6257 |
| 68 | Ga0466699_073283 | 3300042597 | Bacteria | 3045 |
| 69 | Ga0466699_358074 | 3300042597 | Bacteria | 1322 |
| 70 | AustNasuHG_c1028219 | 3300000089 | Bacteria | 1683 |
| 71 | JGI24698J34947_10001402 | 3300002449 | Bacteria | 12684 |
| 72 | JGI24698J34947_10174268 | 3300002449 | Bacteria | 867 |
| 73 | JGI24695J34938_10374110 | 3300002450 | Bacteria | 630 |
| 74 | Ga0072941_1038001 | 3300005201 | Bacteria | 5307 |
| 75 | Ga0466718_025080 | 3300042617 | Bacteria | 2619 |
| 76 | Ga0466718_152494 | 3300042617 | Bacteria | 5833 |
| 77 | Ga0466726_190438 | 3300042619 | Bacteria | 7415 |
| 78 | Ga0466726_303728 | 3300042619 | Bacteria | 1081 |
| 79 | Ga0123356_10000368 | 3300010049 | Bacteria | 51439 |
| 80 | Ga0466716_514987 | 3300042605 | Bacteria | 1090 |
| 81 | Ga0466720_084113 | 3300042607 | Bacteria | 2036 |
| 82 | Ga0466722_008192 | 3300042609 | Bacteria | 9038 |
| 83 | Ga0466722_039643 | 3300042609 | Bacteria | 1109 |
| 84 | Ga0466704_101106 | 3300042643 | Bacteria | 2346 |
| 85 | Ga0264413_113989 | 3300024493 | Bacteria | 4108 |
| 86 | Ga0264413_121041 | 3300024493 | Bacteria | 1632 |
| 87 | Ga0466699_119942 | 3300042597 | Bacteria | 9955 |
| 88 | FAAS_10328248 | 3300001880 | Bacteria | 519 |
| 89 | JGI24698J34947_10103091 | 3300002449 | Bacteria | 1277 |
| 90 | JGI24695J34938_10000319 | 3300002450 | Bacteria | 47237 |
| 91 | JGI24695J34938_10065752 | 3300002450 | Bacteria | 1530 |
| 92 | Ga0072941_1014513 | 3300005201 | Bacteria | 13339 |
| 93 | Ga0466711_118081 | 3300042615 | Unclassified | 4165 |
| 94 | Ga0466711_361678 | 3300042615 | Bacteria | 1154 |
| 95 | Ga0466718_114323 | 3300042617 | Bacteria | 1306 |
| 96 | Ga0466718_116520 | 3300042617 | Bacteria | 1311 |
| 97 | Ga0466718_129352 | 3300042617 | Bacteria | 6068 |
| 98 | Ga0466726_362727 | 3300042619 | Bacteria | 1780 |
| 99 | Ga0466705_085824 | 3300042612 | Unclassified | 2239 |
| 100 | Ga0123355_10443569 | 3300009826 | Bacteria | 1641 |
| 101 | Ga0123356_11895750 | 3300010049 | Bacteria | 742 |
| 102 | Ga0466720_088123 | 3300042607 | Bacteria | 1941 |
| 103 | Ga0466720_189519 | 3300042607 | Bacteria | 2644 |
| 104 | Ga0466722_005252 | 3300042609 | Bacteria | 2765 |
| 105 | Ga0466722_158352 | 3300042609 | Bacteria | 1803 |
| 106 | Ga0466704_615028 | 3300042643 | Bacteria | 8076 |
| 107 | Ga0466709_254481 | 3300042648 | Unclassified | 2731 |
| 108 | Ga0466708_376662 | 3300042652 | Bacteria | 2633 |
| 109 | Ga0466691_029219 | 3300042593 | Bacteria | 2821 |
| 110 | JGI24702J35022_10060836 | 3300002462 | Bacteria | 2019 |
| 111 | Ga0068302_10060833 | 3300005071 | Bacteria | 667 |
| 112 | Ga0072941_1038002 | 3300005201 | Bacteria | 1785 |
| 113 | Ga0466726_219406 | 3300042619 | Bacteria | 1328 |
| 114 | Ga0466705_102925 | 3300042612 | Bacteria | 1039 |
| 115 | Ga0466732_408237 | 3300042656 | Bacteria | 1475 |
| 116 | Ga0466707_378099 | 3300042601 | Bacteria | 1805 |
| 117 | Ga0466720_005219 | 3300042607 | Bacteria | 2413 |
| 118 | Ga0466720_044494 | 3300042607 | Bacteria | 2796 |
| 119 | Ga0466720_074377 | 3300042607 | Bacteria | 1176 |
| 120 | Ga0466722_057704 | 3300042609 | Bacteria | 2589 |
| 121 | Ga0466727_106198 | 3300042655 | Bacteria | 1087 |
| 122 | JGI24698J34947_10083481 | 3300002449 | Bacteria | 1490 |
| 123 | Ga0466718_032174 | 3300042617 | Bacteria | 1415 |
| 124 | Ga0466718_049068 | 3300042617 | Bacteria | 2484 |
| 125 | Ga0466718_114213 | 3300042617 | Bacteria | 2296 |
| 126 | Ga0123356_10054909 | 3300010049 | Bacteria | 3710 |
| 127 | Ga0123356_10828022 | 3300010049 | Bacteria | 1097 |
| 128 | Ga0466722_000419 | 3300042609 | Bacteria | 2076 |
| 129 | Ga0466704_581287 | 3300042643 | Bacteria | 1401 |
| 130 | Ga0264413_105721 | 3300024493 | Bacteria | 10347 |
| 131 | Ga0466694_087548 | 3300042594 | Bacteria | 2022 |
| 132 | AustNasuHG_c1000997 | 3300000089 | Bacteria | 10219 |
| 133 | AustNasuHG_c1026660 | 3300000089 | Bacteria | 1795 |
| 134 | JGI24695J34938_10020761 | 3300002450 | Bacteria | 3227 |
| 135 | JGI24695J34938_10039332 | 3300002450 | Bacteria | 2138 |
| 136 | JGI24695J34938_10334001 | 3300002450 | Bacteria | 662 |
| 137 | JGI24702J35022_10089457 | 3300002462 | Bacteria | 1674 |
| 138 | Ga0466705_394772 | 3300042612 | Bacteria | 1027 |
| 139 | Ga0466711_175970 | 3300042615 | Bacteria | 13722 |
| 140 | Ga0466728_312947 | 3300042620 | Bacteria | 1832 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13470 | PIN_3 | PIN domain | 10 | 125 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.