Protein Family IF05571
Metagenome
Isolate
182
Members
37
Samples
179
Scaffolds
379.02
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_030011|Ga0466706_030011_9429_10613
- Length
- 394 aa
- Sequence
- MIIIFMGGKMETLFENVQNITISHIAMWLIGGILIYLAIKKDMEPTLLLPMGFGAILANLPMSGAVTQFISHSTDGQTTTKAEHGILDLLFDNGITNELFPLLLFIGIGAMIDFGPLISNPKMFLFGAAAHFGIFFTLSLAALIGFDLKDSASIAAIGTADGPTAIFVSMYFDSNYIGAILVAAYSYMALVPIIQPAVIKAVTTKKERLIRMEYKPSTVSQTTKILMPIAITVIAGIVTPRSVALVGFLMFGNLIRECGVLNSLSDTAQKAFANIITLMLGITVAARMQADVFLSKQTVMILGLGLIAFIFDTVGGVLFAKFLNLFLKNKVNPMIGAAGISAFPMSSRVIHKMGLKEDPFNFLLMHAAGANVSGQVASAIAGGLVIVLVEQFIG
Sample Types
Isolate
1.6%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.1%
Termitidae
30.6%
Unclassified
13.9%
Rhinotermitidae
8.3%
Termopsidae
8.3%
Hodotermitidae
2.8%
Taxonomy
Archaea
0
Bacteria
149
Eukaryota
0
Viruses
1
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 6 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 16 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 27 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 36 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 37 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_006562 | 3300042590 | Bacteria | 8414 |
| 2 | Ga0466691_180980 | 3300042593 | Bacteria | 11427 |
| 3 | Ga0466705_069148 | 3300042612 | Unclassified | 3539 |
| 4 | Ga0466705_101101 | 3300042612 | Unclassified | 2884 |
| 5 | Ga0466733_068466 | 3300042659 | Bacteria | 1953 |
| 6 | Ga0466733_105400 | 3300042659 | Bacteria | 13353 |
| 7 | Ga0466720_098265 | 3300042607 | Bacteria | 6085 |
| 8 | Ga0466705_514785 | 3300042612 | Unclassified | 3995 |
| 9 | Ga0466712_071128 | 3300042614 | Unclassified | 6313 |
| 10 | Ga0466715_154931 | 3300042616 | Bacteria | 6914 |
| 11 | Ga0466715_159019 | 3300042616 | Bacteria | 18045 |
| 12 | Ga0466723_069830 | 3300042618 | Bacteria | 59394 |
| 13 | Ga0466723_201928 | 3300042618 | Bacteria | 10765 |
| 14 | Ga0466723_246471 | 3300042618 | Bacteria | 3359 |
| 15 | Ga0466735_014240 | 3300042624 | Bacteria | 10038 |
| 16 | Ga0466703_406401 | 3300042636 | Bacteria | 13196 |
| 17 | Ga0466704_106361 | 3300042643 | Unclassified | 4846 |
| 18 | Ga0466704_219869 | 3300042643 | Bacteria | 5159 |
| 19 | Ga0466704_237932 | 3300042643 | Bacteria | 13635 |
| 20 | Ga0466709_410871 | 3300042648 | Bacteria | 3646 |
| 21 | Ga0466708_048916 | 3300042652 | Bacteria | 3243 |
| 22 | Ga0466691_068061 | 3300042593 | Bacteria | 7933 |
| 23 | Ga0466691_096440 | 3300042593 | Bacteria | 6027 |
| 24 | Ga0466691_220175 | 3300042593 | Bacteria | 9887 |
| 25 | Ga0466733_171912 | 3300042659 | Unclassified | 1880 |
| 26 | Ga0466733_200300 | 3300042659 | Unclassified | 1884 |
| 27 | AustNasuHG_c1009436 | 3300000089 | Bacteria | 3426 |
| 28 | Ga0466700_086100 | 3300042600 | Bacteria | 2001 |
| 29 | Ga0466714_093603 | 3300042603 | Bacteria | 3250 |
| 30 | Ga0466716_032121 | 3300042605 | Bacteria | 1495 |
| 31 | Ga0466719_011761 | 3300042606 | Bacteria | 5203 |
| 32 | Ga0466719_071308 | 3300042606 | Bacteria | 22950 |
| 33 | Ga0466719_577164 | 3300042606 | Bacteria | 2112 |
| 34 | Ga0466720_028793 | 3300042607 | Bacteria | 6911 |
| 35 | Ga0466720_146539 | 3300042607 | Bacteria | 24774 |
| 36 | Ga0466720_162381 | 3300042607 | Bacteria | 6690 |
| 37 | Ga0466722_241539 | 3300042609 | Bacteria | 1873 |
| 38 | Ga0466705_474887 | 3300042612 | Bacteria | 10000 |
| 39 | Ga0466705_494492 | 3300042612 | Bacteria | 14565 |
| 40 | Ga0466715_271824 | 3300042616 | Unclassified | 1448 |
| 41 | Ga0466715_415245 | 3300042616 | Unclassified | 2671 |
| 42 | Ga0466715_424591 | 3300042616 | Bacteria | 27710 |
| 43 | Ga0466718_057873 | 3300042617 | Bacteria | 2180 |
| 44 | Ga0466735_127092 | 3300042624 | Bacteria | 1752 |
| 45 | Ga0466703_075154 | 3300042636 | Bacteria | 5909 |
| 46 | Ga0466703_106546 | 3300042636 | Unclassified | 4750 |
| 47 | Ga0466704_096890 | 3300042643 | Bacteria | 13062 |
| 48 | Ga0466704_368440 | 3300042643 | Bacteria | 28623 |
| 49 | Ga0466708_005306 | 3300042652 | Bacteria | 20730 |
| 50 | Ga0466690_168955 | 3300042590 | Bacteria | 5360 |
| 51 | Ga0466705_361923 | 3300042612 | Bacteria | 3119 |
| 52 | Ga0466732_152032 | 3300042656 | Bacteria | 16830 |
| 53 | Ga0466733_078855 | 3300042659 | Unclassified | 1425 |
| 54 | Ga0466733_084461 | 3300042659 | Bacteria | 10545 |
| 55 | AustNasuHG_c1000871 | 3300000089 | Bacteria | 10868 |
| 56 | JGI24698J34947_10000023 | 3300002449 | Unclassified | 40376 |
| 57 | Ga0466719_251696 | 3300042606 | Unclassified | 3154 |
| 58 | Ga0466723_283666 | 3300042618 | Bacteria | 4141 |
| 59 | Ga0466726_291496 | 3300042619 | Bacteria | 1602 |
| 60 | Ga0466728_129411 | 3300042620 | Bacteria | 2479 |
| 61 | Ga0466728_130565 | 3300042620 | Unclassified | 2274 |
| 62 | Ga0466703_038890 | 3300042636 | Bacteria | 6015 |
| 63 | Ga0466703_349768 | 3300042636 | Bacteria | 4494 |
| 64 | Ga0466704_072274 | 3300042643 | Bacteria | 12914 |
| 65 | Ga0466708_003740 | 3300042652 | Bacteria | 6601 |
| 66 | Ga0466692_196796 | 3300042591 | Bacteria | 14619 |
| 67 | Ga0466694_393466 | 3300042594 | Bacteria | 7737 |
| 68 | Ga0466696_009318 | 3300042596 | Bacteria | 1674 |
| 69 | Ga0466696_028437 | 3300042596 | Bacteria | 47665 |
| 70 | Ga0466705_073291 | 3300042612 | Bacteria | 12223 |
| 71 | Ga0466707_073684 | 3300042601 | Bacteria | 21760 |
| 72 | Ga0466720_022840 | 3300042607 | Bacteria | 22355 |
| 73 | Ga0466720_064141 | 3300042607 | Bacteria | 5549 |
| 74 | Ga0466722_235988 | 3300042609 | Bacteria | 8541 |
| 75 | Ga0466715_078641 | 3300042616 | Bacteria | 15592 |
| 76 | Ga0466726_051852 | 3300042619 | Bacteria | 3888 |
| 77 | Ga0466703_398917 | 3300042636 | Bacteria | 20493 |
| 78 | Ga0466704_200729 | 3300042643 | Bacteria | 13857 |
| 79 | Ga0466704_470402 | 3300042643 | Unclassified | 3115 |
| 80 | Ga0466709_151248 | 3300042648 | Bacteria | 3855 |
| 81 | Ga0466708_191338 | 3300042652 | Bacteria | 35692 |
| 82 | Ga0466727_099657 | 3300042655 | Bacteria | 3092 |
| 83 | Ga0466690_309444 | 3300042590 | Bacteria | 5502 |
| 84 | Ga0466696_059390 | 3300042596 | Bacteria | 7945 |
| 85 | Ga0466733_171418 | 3300042659 | Bacteria | 3187 |
| 86 | JGI24698J34947_10034224 | 3300002449 | Bacteria | 2660 |
| 87 | Ga0466707_276498 | 3300042601 | Bacteria | 2654 |
| 88 | Ga0466719_050547 | 3300042606 | Bacteria | 1711 |
| 89 | Ga0466719_251531 | 3300042606 | Bacteria | 2678 |
| 90 | Ga0466719_260578 | 3300042606 | Bacteria | 9429 |
| 91 | Ga0466719_441021 | 3300042606 | Bacteria | 1423 |
| 92 | Ga0466720_027066 | 3300042607 | Bacteria | 16538 |
| 93 | Ga0466720_077952 | 3300042607 | Bacteria | 14116 |
| 94 | Ga0466720_224416 | 3300042607 | Unclassified | 1124 |
| 95 | Ga0466722_007971 | 3300042609 | Bacteria | 7351 |
| 96 | Ga0466712_144239 | 3300042614 | Unclassified | 13881 |
| 97 | Ga0466712_182761 | 3300042614 | Unclassified | 4410 |
| 98 | Ga0466715_180695 | 3300042616 | Unclassified | 1275 |
| 99 | Ga0466723_182368 | 3300042618 | Bacteria | 25039 |
| 100 | Ga0466728_053679 | 3300042620 | Unclassified | 8046 |
| 101 | Ga0466728_087803 | 3300042620 | Bacteria | 9911 |
| 102 | Ga0466703_150792 | 3300042636 | Bacteria | 36888 |
| 103 | Ga0466704_204727 | 3300042643 | Unclassified | 3534 |
| 104 | Ga0466704_267690 | 3300042643 | Bacteria | 21009 |
| 105 | Ga0466704_307438 | 3300042643 | Bacteria | 3741 |
| 106 | Ga0466704_373750 | 3300042643 | Unclassified | 3042 |
| 107 | Ga0466708_137543 | 3300042652 | Bacteria | 8906 |
| 108 | Ga0466708_299191 | 3300042652 | Bacteria | 8296 |
| 109 | Ga0466690_209699 | 3300042590 | Unclassified | 1918 |
| 110 | Ga0466692_174065 | 3300042591 | Bacteria | 1373 |
| 111 | Ga0466705_191406 | 3300042612 | Bacteria | 8102 |
| 112 | Ga0466705_243647 | 3300042612 | Bacteria | 6971 |
| 113 | Ga0072941_1019989 | 3300005201 | Bacteria | 13382 |
| 114 | Ga0466719_121390 | 3300042606 | Bacteria | 14080 |
| 115 | Ga0466720_238508 | 3300042607 | Bacteria | 16615 |
| 116 | Ga0466705_514837 | 3300042612 | Unclassified | 2332 |
| 117 | Ga0466712_136276 | 3300042614 | Bacteria | 1613 |
| 118 | Ga0466715_047636 | 3300042616 | Bacteria | 7321 |
| 119 | Ga0466715_204590 | 3300042616 | Bacteria | 3841 |
| 120 | Ga0466715_288940 | 3300042616 | Bacteria | 1414 |
| 121 | Ga0466718_045187 | 3300042617 | Bacteria | 2650 |
| 122 | Ga0466723_061573 | 3300042618 | Bacteria | 9768 |
| 123 | Ga0466723_178961 | 3300042618 | Unclassified | 5002 |
| 124 | Ga0466728_000843 | 3300042620 | Bacteria | 1917 |
| 125 | Ga0466703_081736 | 3300042636 | Bacteria | 1962 |
| 126 | Ga0466704_043537 | 3300042643 | Bacteria | 2803 |
| 127 | Ga0466704_118416 | 3300042643 | Bacteria | 7868 |
| 128 | Ga0466704_205172 | 3300042643 | Bacteria | 10224 |
| 129 | Ga0466704_303311 | 3300042643 | Unclassified | 2719 |
| 130 | Ga0466704_320486 | 3300042643 | Bacteria | 1864 |
| 131 | Ga0466708_216753 | 3300042652 | Unclassified | 1652 |
| 132 | Ga0466708_387161 | 3300042652 | Bacteria | 1919 |
| 133 | Ga0466691_022374 | 3300042593 | Bacteria | 3148 |
| 134 | Ga0466696_021824 | 3300042596 | Bacteria | 10574 |
| 135 | Ga0466696_084711 | 3300042596 | Bacteria | 44294 |
| 136 | Ga0466696_097854 | 3300042596 | Bacteria | 2995 |
| 137 | Ga0466696_382313 | 3300042596 | Bacteria | 5408 |
| 138 | Ga0466699_349810 | 3300042597 | Bacteria | 2052 |
| 139 | Ga0466733_067829 | 3300042659 | Bacteria | 52214 |
| 140 | JGI24698J34947_10003973 | 3300002449 | Bacteria | 8045 |
| 141 | Ga0466713_026765 | 3300042602 | Bacteria | 8454 |
| 142 | Ga0466719_120558 | 3300042606 | Bacteria | 14997 |
| 143 | Ga0466719_253117 | 3300042606 | Bacteria | 34280 |
| 144 | Ga0466719_309136 | 3300042606 | Bacteria | 27413 |
| 145 | Ga0466719_359999 | 3300042606 | Unclassified | 3365 |
| 146 | Ga0466720_064367 | 3300042607 | Bacteria | 2435 |
| 147 | Ga0466722_165503 | 3300042609 | Bacteria | 3307 |
| 148 | Ga0466712_206989 | 3300042614 | Bacteria | 5924 |
| 149 | Ga0466715_111926 | 3300042616 | Unclassified | 2338 |
| 150 | Ga0466726_396876 | 3300042619 | Bacteria | 1506 |
| 151 | Ga0466726_428818 | 3300042619 | Bacteria | 1957 |
| 152 | Ga0466735_066942 | 3300042624 | Bacteria | 1219 |
| 153 | Ga0466735_229039 | 3300042624 | Bacteria | 2683 |
| 154 | Ga0466703_078013 | 3300042636 | Bacteria | 3426 |
| 155 | Ga0466703_202464 | 3300042636 | Bacteria | 12685 |
| 156 | Ga0466703_296916 | 3300042636 | Bacteria | 11746 |
| 157 | Ga0466703_343381 | 3300042636 | Bacteria | 12999 |
| 158 | Ga0466703_366766 | 3300042636 | Bacteria | 1498 |
| 159 | Ga0466704_111778 | 3300042643 | Bacteria | 18468 |
| 160 | Ga0466704_253487 | 3300042643 | Bacteria | 36226 |
| 161 | Ga0466696_102907 | 3300042596 | Bacteria | 26617 |
| 162 | Ga0466705_168059 | 3300042612 | Bacteria | 4398 |
| 163 | Ga0466733_187032 | 3300042659 | Unclassified | 2104 |
| 164 | JGI24698J34947_10001654 | 3300002449 | Bacteria | 11874 |
| 165 | Ga0466706_030011 | 3300042599 | Bacteria | 12540 |
| 166 | Ga0466706_083264 | 3300042599 | Viruses | 2511 |
| 167 | Ga0466707_301927 | 3300042601 | Bacteria | 1929 |
| 168 | Ga0466719_028018 | 3300042606 | Bacteria | 1486 |
| 169 | Ga0466719_158352 | 3300042606 | Bacteria | 16812 |
| 170 | Ga0466719_173012 | 3300042606 | Bacteria | 4711 |
| 171 | Ga0466719_282182 | 3300042606 | Bacteria | 5143 |
| 172 | Ga0466720_177676 | 3300042607 | Bacteria | 91443 |
| 173 | Ga0466715_173865 | 3300042616 | Bacteria | 3654 |
| 174 | Ga0466715_214283 | 3300042616 | Unclassified | 1491 |
| 175 | Ga0466715_306652 | 3300042616 | Bacteria | 11984 |
| 176 | Ga0466723_043374 | 3300042618 | Bacteria | 3220 |
| 177 | Ga0466729_120812 | 3300042621 | Bacteria | 1948 |
| 178 | Ga0466735_012698 | 3300042624 | Bacteria | 7642 |
| 179 | Ga0466703_117378 | 3300042636 | Unclassified | 5809 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03977 | OAD_beta | Na+-transporting oxaloacetate decarboxylase beta subunit | 24 | 388 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.