Protein Family IF05524
Metagenome
Isolate
179
Members
131
Samples
96
Scaffolds
187.26
Avg Length
Representative Sequence
- ID
- 3300042598|Ga0466701_088071|Ga0466701_088071_26802_27452
- Length
- 216 aa
- Sequence
- MGSVPQAQSGLAPALIEQGTAMGNRLSQIATRTGDDGTTGLGDNTRVSKNSGRPHAMGDVDELNSHIGLLLCEPLPQDVRDLLIDIQHQLFNLGGELSMPGYELLKDDALLQLDNALAHYNAQLPRLLEFILPAGTRAASQAHVCRTVARRAERHVVALEQAEAMRAAPRQYLNRLSDLLFVLARVLNRVDGGDDVYWKSERLARSQAEDGQAPEA
Sample Types
Isolate
46.4%
Metagenome
53.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
44.8%
Termitidae
12.0%
Culicidae
8.8%
Elmidae
6.4%
Kalotermitidae
6.4%
Armadillidiidae
5.6%
Curculionidae
3.2%
Hydrophilidae
2.4%
Sarcophagidae
2.4%
Largidae
1.6%
Unclassified
1.6%
Alydidae
1.6%
Passalidae
0.8%
Drosophilidae
0.8%
Berytidae
0.8%
Cixiidae
0.8%
Taxonomy
Archaea
0
Bacteria
164
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 2 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 3 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 4 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 7 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 8 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 9 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 10 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 11 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 12 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 13 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 14 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 15 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 16 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 17 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 18 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 19 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 27 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 28 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 29 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 30 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 31 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 32 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 33 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 34 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 35 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 36 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 37 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 40 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 41 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 44 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 45 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 46 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 47 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 48 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 49 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 50 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 51 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 52 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 53 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 54 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 55 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 56 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 57 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 58 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 59 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 60 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 61 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 62 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 63 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 64 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 65 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 66 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 67 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 68 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 69 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 70 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 71 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 72 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 73 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 74 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 75 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 76 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 77 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 78 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 79 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 80 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 81 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 82 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 83 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 84 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 85 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 86 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 87 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 88 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 89 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 90 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 91 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 92 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 93 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 94 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 95 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 96 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 97 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 98 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 99 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 100 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 101 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 102 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 103 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 104 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 105 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 106 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 107 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 108 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 109 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 110 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 111 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 112 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 113 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 114 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 115 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 116 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 117 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 118 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 119 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 120 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 121 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 122 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 123 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 124 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 125 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 126 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 127 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 128 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 129 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 130 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 131 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_323180 | 3300042612 | Bacteria | 13365 |
| 2 | Ga0466701_066043 | 3300042598 | Bacteria | 1727 |
| 3 | Ga0466701_076366 | 3300042598 | Unclassified | 9322 |
| 4 | Ga0160432_101208 | 3300012818 | Bacteria | 9194 |
| 5 | Ga0160469_100012 | 3300012824 | Bacteria | 446228 |
| 6 | Ga0160459_102892 | 3300012831 | Bacteria | 2604 |
| 7 | Ga0160446_101111 | 3300012835 | Unclassified | 6510 |
| 8 | Ga0160455_100799 | 3300012837 | Bacteria | 12481 |
| 9 | Ga0160444_100047 | 3300012841 | Bacteria | 183558 |
| 10 | Ga0160447_109881 | 3300012849 | Bacteria | 2142 |
| 11 | Ga0160457_1000462 | 3300012858 | Bacteria | 18826 |
| 12 | Ga0466695_168108 | 3300042595 | Bacteria | 10898 |
| 13 | Ga0466710_215475 | 3300042613 | Bacteria | 1372 |
| 14 | Ga0466710_291775 | 3300042613 | Bacteria | 1192 |
| 15 | Ga0466710_344440 | 3300042613 | Bacteria | 2776 |
| 16 | Ga0466701_062004 | 3300042598 | Bacteria | 44212 |
| 17 | Ga0160470_101435 | 3300012813 | Bacteria | 5767 |
| 18 | Ga0160469_100122 | 3300012824 | Bacteria | 105884 |
| 19 | Ga0160433_100234 | 3300012846 | Unclassified | 40720 |
| 20 | Ga0466731_185402 | 3300042622 | Bacteria | 3752 |
| 21 | Ga0466708_070853 | 3300042652 | Bacteria | 2977 |
| 22 | Ga0160440_100012 | 3300012815 | Bacteria | 357729 |
| 23 | Ga0160432_100364 | 3300012818 | Bacteria | 33570 |
| 24 | Ga0160455_100051 | 3300012837 | Bacteria | 249063 |
| 25 | Ga0160460_107609 | 3300012845 | Bacteria | 1421 |
| 26 | Ga0160433_103924 | 3300012846 | Unclassified | 2500 |
| 27 | Ga0160434_110474 | 3300012850 | Unclassified | 1504 |
| 28 | Ga0160436_1001408 | 3300012861 | Unclassified | 6603 |
| 29 | Ga0466694_131098 | 3300042594 | Bacteria | 3407 |
| 30 | Ga0104048_1171196 | 3300007143 | Bacteria | 1530 |
| 31 | Ga0123356_10019366 | 3300010049 | Bacteria | 6450 |
| 32 | Ga0160471_100049 | 3300012812 | Bacteria | 163291 |
| 33 | Ga0160471_100628 | 3300012812 | Bacteria | 9040 |
| 34 | Ga0466734_152953 | 3300042623 | Bacteria | 10727 |
| 35 | Ga0466734_172809 | 3300042623 | Bacteria | 6986 |
| 36 | Ga0466730_004769 | 3300042625 | Bacteria | 209482 |
| 37 | Ga0466724_45911 | 3300042649 | Bacteria | 295309 |
| 38 | Ga0466725_003295 | 3300042654 | Bacteria | 4401 |
| 39 | Ga0466701_047638 | 3300042598 | Bacteria | 47857 |
| 40 | Ga0160469_100076 | 3300012824 | Bacteria | 158417 |
| 41 | Ga0160459_100038 | 3300012831 | Bacteria | 234319 |
| 42 | Ga0160460_100805 | 3300012845 | Bacteria | 14180 |
| 43 | Ga0160445_123240 | 3300012847 | Bacteria | 802 |
| 44 | Ga0160434_100070 | 3300012850 | Bacteria | 71817 |
| 45 | Ga0466693_168993 | 3300042592 | Bacteria | 1776 |
| 46 | Ga0466691_122937 | 3300042593 | Bacteria | 12313 |
| 47 | Ga0160470_100007 | 3300012813 | Bacteria | 492874 |
| 48 | Ga0466730_038558 | 3300042625 | Bacteria | 566435 |
| 49 | Ga0466724_30050 | 3300042649 | Bacteria | 3151 |
| 50 | Ga0466724_58595 | 3300042649 | Bacteria | 137649 |
| 51 | Ga0160453_103084 | 3300012814 | Bacteria | 3629 |
| 52 | Ga0160444_101182 | 3300012841 | Bacteria | 5730 |
| 53 | Ga0160443_100769 | 3300012848 | Unclassified | 16489 |
| 54 | Ga0160448_100278 | 3300012854 | Bacteria | 19952 |
| 55 | Ga0160435_1007674 | 3300012857 | Unclassified | 2347 |
| 56 | Ga0466657_315276 | 3300042582 | Bacteria | 4457 |
| 57 | Ga0160466_101008 | 3300012809 | Bacteria | 9617 |
| 58 | Ga0466715_570356 | 3300042616 | Bacteria | 5580 |
| 59 | Ga0466731_322894 | 3300042622 | Bacteria | 3440 |
| 60 | Ga0466734_121696 | 3300042623 | Unclassified | 2452 |
| 61 | Ga0466724_63872 | 3300042649 | Bacteria | 73403 |
| 62 | Ga0160448_113550 | 3300012854 | Bacteria | 1549 |
| 63 | Ga0466657_111391 | 3300042582 | Bacteria | 2200 |
| 64 | Ga0466690_142458 | 3300042590 | Bacteria | 24638 |
| 65 | Ga0466699_101488 | 3300042597 | Bacteria | 1469 |
| 66 | Ga0072941_1009391 | 3300005201 | Bacteria | 14543 |
| 67 | Ga0123356_10268501 | 3300010049 | Bacteria | 1794 |
| 68 | Ga0123356_10345423 | 3300010049 | Bacteria | 1610 |
| 69 | Ga0466730_055911 | 3300042625 | Bacteria | 12879 |
| 70 | Ga0466703_051520 | 3300042636 | Bacteria | 8470 |
| 71 | Ga0466708_377562 | 3300042652 | Bacteria | 2129 |
| 72 | Ga0466701_061678 | 3300042598 | Bacteria | 207542 |
| 73 | Ga0466701_098447 | 3300042598 | Bacteria | 82442 |
| 74 | Ga0466721_314789 | 3300042608 | Bacteria | 3196 |
| 75 | Ga0160472_102295 | 3300012839 | Unclassified | 4432 |
| 76 | Ga0160472_106562 | 3300012839 | Unclassified | 1718 |
| 77 | IMNBGM34_c000229 | 3300000036 | Bacteria | 16287 |
| 78 | Ga0123356_10115130 | 3300010049 | Bacteria | 2605 |
| 79 | Ga0160471_105374 | 3300012812 | Bacteria | 1693 |
| 80 | Ga0466734_034261 | 3300042623 | Bacteria | 15895 |
| 81 | Ga0466730_097556 | 3300042625 | Bacteria | 1138 |
| 82 | Ga0466724_28563 | 3300042649 | Unclassified | 25410 |
| 83 | Ga0466701_088071 | 3300042598 | Bacteria | 194232 |
| 84 | Ga0466719_253230 | 3300042606 | Bacteria | 1269 |
| 85 | Ga0160445_100038 | 3300012847 | Bacteria | 165284 |
| 86 | Ga0160447_100956 | 3300012849 | Unclassified | 12022 |
| 87 | Ga0466657_390639 | 3300042582 | Bacteria | 2018 |
| 88 | Ga0466657_403642 | 3300042582 | Bacteria | 2281 |
| 89 | SPBB_contig02363 | 2044078006 | Unclassified | 2248 |
| 90 | Ga0123355_10444720 | 3300009826 | Unclassified | 1638 |
| 91 | Ga0123355_10620793 | 3300009826 | Bacteria | 1274 |
| 92 | Ga0466728_115537 | 3300042620 | Bacteria | 20182 |
| 93 | Ga0466734_079939 | 3300042623 | Bacteria | 1009 |
| 94 | Ga0466730_036782 | 3300042625 | Bacteria | 3594 |
| 95 | Ga0466730_040482 | 3300042625 | Bacteria | 53350 |
| 96 | Ga0466725_335385 | 3300042654 | Bacteria | 8472 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01923 | Cob_adeno_trans | Cobalamin adenosyltransferase | 29 | 187 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.