Protein Family IF05349

Metagenome Isolate
113 Members
30 Samples
105 Scaffolds
283.23 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_279086|Ga0466699_279086_16_981
Length
321 aa
Sequence
LQIEVKLISNKSLLEKINVFLKSNKAKPIFSPYIWYTVLEVIPVRKKREFIQGAFYHVTSRTNDKIRVFENKLGRKIMLMVLQDAKEKYRFRLANFCVMPTHIHLLIQPEESTHLSTIMQWIKTHSAKRWNNIHGSSDHLWGHRYFARAVKDPQEYEFIMNYIDQNPVKAGLAPSPAEWRASGAYYKAWDIKGLVDFAPYDRQSYIKLLSPIPPIVSHLLPPAQLAHTLQYYGAYAETIEKLYTLVSTIPELGDTETIQNPPTFLRYFTTMADYFVCEYDGQDTMFGKVRSGIHPAETKYQKFSLHNLKSNPSMRLDFSFR

📊 Sample Types

Isolate 7.1%
Metagenome 92.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 71.4%
Unclassified 28.6%

🌳 Taxonomy

Archaea 0
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
2 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
7 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
8 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
19 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
25 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
26 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
27 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
30 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466717_185743 3300042604 Bacteria 1545
2 Ga0466720_027158 3300042607 Bacteria 7289
3 Ga0466720_047951 3300042607 Bacteria 7294
4 Ga0466720_075859 3300042607 Bacteria 3776
5 Ga0466694_118866 3300042594 Bacteria 2452
6 Ga0466699_018642 3300042597 Bacteria 1426
7 Ga0466699_121374 3300042597 Bacteria 2827
8 JGI24695J34938_10087289 3300002450 Bacteria 1283
9 JGI24702J35022_10006731 3300002462 Bacteria 6624
10 Ga0072940_1010877 3300005200 Bacteria 1646
11 Ga0072941_1108036 3300005201 Bacteria 3386
12 Ga0123356_10406548 3300010049 Bacteria 1500
13 Ga0466712_044909 3300042614 Bacteria 10576
14 Ga0466712_221572 3300042614 Bacteria 1868
15 Ga0466718_013984 3300042617 Bacteria 6504
16 Ga0466720_129231 3300042607 Bacteria 5752
17 Ga0466720_133637 3300042607 Bacteria 7513
18 Ga0466698_341807 3300042610 Bacteria 1606
19 Ga0466698_458678 3300042610 Bacteria 1774
20 Ga0264413_118805 3300024493 Bacteria 3350
21 Ga0466699_156014 3300042597 Bacteria 2148
22 AustNasuHG_c1030791 3300000089 Bacteria 1534
23 JGI24698J34947_10018611 3300002449 Bacteria 3750
24 JGI24698J34947_10068996 3300002449 Bacteria 1707
25 Ga0123353_11146559 3300010167 Bacteria 1026
26 Ga0466698_337707 3300042610 Bacteria 1480
27 Ga0466731_171820 3300042622 Bacteria 1164
28 Ga0466694_234507 3300042594 Bacteria 1126
29 Ga0466699_289036 3300042597 Bacteria 1421
30 Ga0466699_416859 3300042597 Bacteria 1946
31 AustNasuHG_c1042859 3300000089 Bacteria 1071
32 Ga0123356_10441268 3300010049 Unclassified 1448
33 Ga0123356_10661776 3300010049 Bacteria 1212
34 Ga0123353_10259767 3300010167 Bacteria 2684
35 Ga0466712_234544 3300042614 Bacteria 5367
36 Ga0466721_081037 3300042608 Bacteria 36334
37 JGI24695J34938_10060496 3300002450 Bacteria 1616
38 Ga0123356_10184082 3300010049 Bacteria 2113
39 Ga0466720_109697 3300042607 Bacteria 6947
40 Ga0466720_237262 3300042607 Bacteria 2640
41 Ga0466698_150868 3300042610 Bacteria 1314
42 Ga0466702_215882 3300042635 Bacteria 1566
43 Ga0264413_121794 3300024493 Bacteria 1343
44 Ga0264413_150970 3300024493 Bacteria 1183
45 Ga0466694_365048 3300042594 Bacteria 1140
46 Ga0466699_178522 3300042597 Bacteria 8748
47 Ga0466699_279086 3300042597 Bacteria 1105
48 Ga0466699_349116 3300042597 Bacteria 1392
49 Ga0466699_384804 3300042597 Bacteria 1235
50 Ga0466699_428648 3300042597 Bacteria 1711
51 AustNasuHG_c1007099 3300000089 Bacteria 3989
52 AustNasuHG_c1041827 3300000089 Bacteria 1099
53 JGI24698J34947_10023155 3300002449 Bacteria 3323
54 Ga0123353_10921442 3300010167 Bacteria 1186
55 Ga0466732_230577 3300042656 Bacteria 2694
56 Ga0466720_021934 3300042607 Bacteria 78212
57 Ga0466720_166520 3300042607 Bacteria 2824
58 Ga0264413_118877 3300024493 Bacteria 2746
59 Ga0466699_021552 3300042597 Bacteria 16840
60 Ga0466699_057157 3300042597 Bacteria 2319
61 AustNasuHG_c1017929 3300000089 Bacteria 2343
62 AustNasuHG_c1029514 3300000089 Bacteria 1603
63 JGI24695J34938_10002833 3300002450 Bacteria 12670
64 JGI24695J34938_10023527 3300002450 Bacteria 2968
65 JGI24702J35022_10198804 3300002462 Bacteria 1146
66 Ga0072941_1040763 3300005201 Bacteria 1380
67 Ga0072941_1112783 3300005201 Bacteria 1271
68 Ga0123356_10000120 3300010049 Bacteria 85763
69 Ga0123356_10002920 3300010049 Bacteria 18099
70 Ga0123356_10191552 3300010049 Bacteria 2076
71 Ga0466712_106189 3300042614 Bacteria 4115
72 Ga0466718_080895 3300042617 Bacteria 3505
73 Ga0466732_116630 3300042656 Bacteria 1954
74 Ga0466720_040900 3300042607 Bacteria 18087
75 Ga0466720_041178 3300042607 Bacteria 2549
76 Ga0466720_061959 3300042607 Bacteria 9848
77 Ga0466702_315981 3300042635 Bacteria 1188
78 Ga0415639_142077 3300038395 Bacteria 995
79 Ga0466699_032890 3300042597 Bacteria 1954
80 Ga0466699_418735 3300042597 Bacteria 4056
81 JGI24698J34947_10011458 3300002449 Bacteria 4869
82 JGI24695J34938_10001710 3300002450 Bacteria 18145
83 JGI24695J34938_10034111 3300002450 Bacteria 2336
84 Ga0072941_1017058 3300005201 Bacteria 18391
85 Ga0072941_1077255 3300005201 Bacteria 1044
86 Ga0072941_1244967 3300005201 Bacteria 2074
87 Ga0123355_10145669 3300009826 Bacteria 3612
88 Ga0123356_10000432 3300010049 Bacteria 47836
89 Ga0466712_097818 3300042614 Bacteria 14218
90 Ga0466718_086776 3300042617 Bacteria 73105
91 Ga0466694_159453 3300042594 Bacteria 1893
92 Ga0466694_222939 3300042594 Bacteria 2719
93 Ga0466699_016343 3300042597 Bacteria 2084
94 Ga0466699_215295 3300042597 Bacteria 1050
95 Ga0466699_250710 3300042597 Bacteria 2387
96 Ga0466699_356945 3300042597 Bacteria 2272
97 Ga0466699_397094 3300042597 Bacteria 1675
98 Ga0072941_1008823 3300005201 Bacteria 1389
99 Ga0072941_1032998 3300005201 Bacteria 3691
100 Ga0072941_1046617 3300005201 Bacteria 4249
101 Ga0072941_1197611 3300005201 Bacteria 1321
102 Ga0123356_10000062 3300010049 Bacteria 112695
103 Ga0123353_10891756 3300010167 Bacteria 1212
104 Ga0123353_11081529 3300010167 Bacteria 1067
105 Ga0466712_287731 3300042614 Bacteria 4424

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01797 Y1_Tnp Transposase IS200 like 55 166 0.94

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.