Protein Family IF05335

Metagenome Isolate
120 Members
38 Samples
110 Scaffolds
192.67 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_223269|Ga0466699_223269_94_738
Length
214 aa
Sequence
LTLPPDIVILYIEALSLGDLYSNNLKKMKIIGFSASPRKEGNTAWIINKILEGAKEQGAETQSFYSSDLDIKPCTGCLACVQGDKCVINDDMQQLYDALDQADALILGSPVYMGQMTAQAKIFTDRLYAKITPRFSPHLKEKNAGKKLVLVFTQGNPDSGKFQVYFDYTGQMFQMLEFDVKGVHVIAGMRNEPAHERKELYTTMKDIGSALVLQ

📊 Sample Types

Isolate 7.5%
Metagenome 92.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.2%
Unclassified 24.3%
Kalotermitidae 16.2%
Rhinotermitidae 8.1%
Termopsidae 5.4%
Passalidae 2.7%

🌳 Taxonomy

Archaea 8
Bacteria 95
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
5 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
6 2772190976 Unclassified Bathyarchaeota Co191P4bin18 Isolate Unclassified
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
15 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
16 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
23 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
24 2772190988 Unclassified Bathyarchaeota Co191P1bin46 Isolate Unclassified
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 2772190974 Unclassified Bathyarchaeota Co191P3bin4 Isolate Unclassified
32 2773857694 Methanobrevibacter sp. Th196P4bin56 Isolate Unclassified
33 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
34 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
37 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466718_044591 3300042617 Bacteria 1617
2 Ga0466718_141010 3300042617 Unclassified 2983
3 Ga0466726_161173 3300042619 Bacteria 1080
4 Ga0123357_10346415 3300009784 Bacteria 1428
5 Ga0466692_164261 3300042591 Bacteria 2147
6 Ga0466699_004904 3300042597 Bacteria 1708
7 Ga0466699_016149 3300042597 Bacteria 1067
8 Ga0466699_167450 3300042597 Bacteria 5881
9 Ga0466699_363343 3300042597 Bacteria 13690
10 Ga0072941_1055513 3300005201 Bacteria 3996
11 Ga0466705_035922 3300042612 Bacteria 2848
12 Ga0466716_183581 3300042605 Bacteria 14059
13 Ga0466722_237318 3300042609 Bacteria 1916
14 Ga0466698_081832 3300042610 Bacteria 13747
15 Ga0466705_454142 3300042612 Bacteria 3219
16 Ga0466712_000468 3300042614 Unclassified 1203
17 Ga0466711_227429 3300042615 Bacteria 25883
18 Ga0466718_114305 3300042617 Bacteria 3802
19 Ga0466726_021991 3300042619 Bacteria 5054
20 Ga0466726_198453 3300042619 Bacteria 4156
21 Ga0466726_323407 3300042619 Bacteria 3881
22 Ga0466728_175770 3300042620 Bacteria 1996
23 Ga0466699_088512 3300042597 Bacteria 5021
24 Ga0466699_316134 3300042597 Unclassified 1932
25 Ga0466699_367265 3300042597 Bacteria 2010
26 Ga0466699_440996 3300042597 Unclassified 8085
27 Ga0466718_104096 3300042617 Bacteria 1227
28 Ga0466726_189654 3300042619 Archaea 2408
29 Ga0466729_192175 3300042621 Bacteria 5147
30 Ga0123354_10101737 3300010882 Bacteria 3878
31 Ga0466727_276242 3300042655 Bacteria 3223
32 Ga0466690_353725 3300042590 Bacteria 1378
33 Ga0466693_134228 3300042592 Bacteria 1442
34 Ga0466699_143304 3300042597 Bacteria 3668
35 JGI24702J35022_10061720 3300002462 Bacteria 2006
36 JGI24705J35276_12238804 3300002504 Bacteria 106703
37 JGI24696J40584_12952017 3300002834 Bacteria 2300
38 Ga0466716_058895 3300042605 Bacteria 3193
39 Ga0466712_100312 3300042614 Unclassified 2169
40 Ga0466718_026362 3300042617 Bacteria 1239
41 Ga0466718_088944 3300042617 Bacteria 1292
42 Ga0466726_203646 3300042619 Bacteria 1180
43 Ga0466726_245285 3300042619 Bacteria 5016
44 Ga0466726_429407 3300042619 Bacteria 4462
45 Ga0123353_10108359 3300010167 Bacteria 4477
46 Ga0466699_123366 3300042597 Bacteria 1966
47 Ga0466699_157306 3300042597 Bacteria 1872
48 Ga0466699_230407 3300042597 Bacteria 1011
49 Ga0466699_440980 3300042597 Bacteria 1036
50 Ga0466699_443666 3300042597 Bacteria 17384
51 JGI24702J35022_10004826 3300002462 Bacteria 7965
52 Ga0072941_1476649 3300005201 Bacteria 1429
53 Ga0466720_121170 3300042607 Bacteria 7451
54 Ga0466698_211738 3300042610 Bacteria 2787
55 Ga0466711_008962 3300042615 Bacteria 1685
56 Ga0466726_201555 3300042619 Bacteria 1428
57 Ga0466726_373016 3300042619 Bacteria 10783
58 Ga0123357_10060088 3300009784 Bacteria 5099
59 Ga0123357_10330114 3300009784 Bacteria 1492
60 Ga0123354_10036698 3300010882 Bacteria 7643
61 Ga0466699_401354 3300042597 Bacteria 6178
62 JGI24702J35022_10021016 3300002462 Bacteria 3543
63 JGI24696J40584_12845561 3300002834 Unclassified 966
64 Ga0072940_1244502 3300005200 Unclassified 897
65 Ga0072941_1076799 3300005201 Bacteria 17188
66 Ga0466720_071765 3300042607 Archaea 1583
67 Ga0466718_037789 3300042617 Unclassified 1059
68 Ga0466726_187680 3300042619 Bacteria 7234
69 Ga0123357_10033680 3300009784 Bacteria 6963
70 Ga0123354_10253001 3300010882 Bacteria 1779
71 Ga0466727_126252 3300042655 Bacteria 1110
72 Ga0466727_174230 3300042655 Bacteria 1129
73 Ga0466699_096021 3300042597 Bacteria 1242
74 Ga0466699_196066 3300042597 Unclassified 2958
75 Ga0466699_410051 3300042597 Bacteria 9901
76 2227129435 2225789004 Unclassified 1667
77 JGI24702J35022_10029768 3300002462 Bacteria 2930
78 Ga0074263_129459 3300005485 Unclassified 884
79 Ga0466718_069606 3300042617 Bacteria 2225
80 Ga0466718_113066 3300042617 Bacteria 1302
81 Ga0466718_127808 3300042617 Bacteria 25921
82 Ga0466726_175043 3300042619 Bacteria 1380
83 Ga0466726_434572 3300042619 Bacteria 8151
84 Ga0466704_316140 3300042643 Unclassified 1270
85 Ga0466704_371541 3300042643 Archaea 1845
86 Ga0466727_154831 3300042655 Bacteria 1106
87 Ga0466727_330894 3300042655 Bacteria 1042
88 Ga0466699_024119 3300042597 Bacteria 10616
89 Ga0466699_193825 3300042597 Bacteria 1109
90 Ga0466699_223269 3300042597 Bacteria 1118
91 Ga0466699_406302 3300042597 Archaea 1504
92 2227118867 2225789004 Bacteria 1710
93 JGI24696J40584_12873089 3300002834 Bacteria 1053
94 JGI24696J40584_12961625 3300002834 Unclassified 25807
95 Ga0466707_340183 3300042601 Bacteria 2137
96 Ga0466718_109716 3300042617 Bacteria 1232
97 Ga0466726_230283 3300042619 Bacteria 1190
98 Ga0123357_10482661 3300009784 Bacteria 1046
99 Ga0123353_10342572 3300010167 Bacteria 2257
100 Ga0123353_10358325 3300010167 Bacteria 2193
101 Ga0466693_053310 3300042592 Unclassified 15229
102 Ga0466693_302921 3300042592 Unclassified 1045
103 Ga0466699_066391 3300042597 Unclassified 1509
104 Ga0466699_069968 3300042597 Bacteria 1450
105 Ga0466699_176655 3300042597 Bacteria 4845
106 Ga0466699_249969 3300042597 Bacteria 5774
107 Ga0466699_312271 3300042597 Bacteria 1050
108 2227490483 2225789004 Bacteria 4101
109 JGI24698J34947_10099703 3300002449 Bacteria 1309
110 JGI24705J35276_12151652 3300002504 Bacteria 1186

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03358 FMN_red NADPH-dependent FMN reductase 28 150 0.85
PF02525 Flavodoxin_2 Flavodoxin-like fold 28 195 0.76

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03358 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.