Protein Family IF05330
Metagenome
Isolate
112
Members
28
Samples
110
Scaffolds
155.44
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_216259|Ga0466699_216259_392_913
- Length
- 173 aa
- Sequence
- LIYRKENIMARYTGDSRVKIEGTHVTWSESYSMGIKIIDDQHKGLLDFVNDIFNHASGDEEEERAWFREVIQQAVSYVKEHFATEEKYMIATKFPGYAAHKKIHDEFTLTVINSVKEFDAGKRLVLEKFAYFLKDWVLSHVAVMDRQYSDYFKKIATRKADGKLSITKDDIPS
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
68.0%
Kalotermitidae
24.0%
Unclassified
8.0%
Taxonomy
Archaea
0
Bacteria
105
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 2 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 3 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 4 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 5 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 6 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 7 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 8 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 11 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 12 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 13 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 16 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 17 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_009977 | 3300042600 | Bacteria | 3320 |
| 2 | Ga0466720_090662 | 3300042607 | Bacteria | 2337 |
| 3 | Ga0264413_100439 | 3300024493 | Unclassified | 16720 |
| 4 | Ga0264413_101760 | 3300024493 | Bacteria | 4040 |
| 5 | Ga0264413_128278 | 3300024493 | Bacteria | 1320 |
| 6 | Ga0466690_090763 | 3300042590 | Bacteria | 6471 |
| 7 | Ga0466691_165921 | 3300042593 | Bacteria | 19386 |
| 8 | Ga0466699_046501 | 3300042597 | Bacteria | 12566 |
| 9 | Ga0466699_047352 | 3300042597 | Bacteria | 4116 |
| 10 | Ga0466699_342073 | 3300042597 | Bacteria | 2942 |
| 11 | Ga0466699_431892 | 3300042597 | Bacteria | 1676 |
| 12 | Ga0466708_084764 | 3300042652 | Bacteria | 2597 |
| 13 | JGI24695J34938_10000011 | 3300002450 | Bacteria | 126968 |
| 14 | Ga0072941_1117900 | 3300005201 | Bacteria | 1317 |
| 15 | Ga0466732_124415 | 3300042656 | Bacteria | 10306 |
| 16 | Ga0466715_105586 | 3300042616 | Bacteria | 17333 |
| 17 | Ga0466718_096017 | 3300042617 | Bacteria | 3631 |
| 18 | Ga0466720_022840 | 3300042607 | Bacteria | 22355 |
| 19 | Ga0466720_030592 | 3300042607 | Bacteria | 15558 |
| 20 | Ga0466720_048011 | 3300042607 | Bacteria | 1373 |
| 21 | Ga0466720_105228 | 3300042607 | Bacteria | 20857 |
| 22 | Ga0466720_110596 | 3300042607 | Bacteria | 36874 |
| 23 | Ga0466699_156378 | 3300042597 | Bacteria | 4793 |
| 24 | Ga0466699_204662 | 3300042597 | Unclassified | 1290 |
| 25 | Ga0466699_216259 | 3300042597 | Bacteria | 1523 |
| 26 | Ga0466699_234064 | 3300042597 | Bacteria | 2250 |
| 27 | AustNasuHG_c1027417 | 3300000089 | Bacteria | 1739 |
| 28 | FAAS_10802248 | 3300001880 | Bacteria | 501 |
| 29 | JGI24696J40584_12782612 | 3300002834 | Bacteria | 839 |
| 30 | Ga0466718_079803 | 3300042617 | Bacteria | 12317 |
| 31 | Ga0466718_092153 | 3300042617 | Bacteria | 2603 |
| 32 | Ga0466720_016080 | 3300042607 | Bacteria | 4808 |
| 33 | Ga0466720_028793 | 3300042607 | Bacteria | 6911 |
| 34 | Ga0466720_083972 | 3300042607 | Bacteria | 2383 |
| 35 | Ga0466720_159726 | 3300042607 | Bacteria | 8345 |
| 36 | Ga0264413_116331 | 3300024493 | Bacteria | 10299 |
| 37 | Ga0264413_116915 | 3300024493 | Bacteria | 1256 |
| 38 | Ga0264413_121246 | 3300024493 | Bacteria | 4678 |
| 39 | Ga0466699_205395 | 3300042597 | Bacteria | 2256 |
| 40 | AustNasuHG_c1009436 | 3300000089 | Bacteria | 3426 |
| 41 | AustNasuHG_c1011748 | 3300000089 | Bacteria | 3032 |
| 42 | Ga0466733_158744 | 3300042659 | Bacteria | 1318 |
| 43 | Ga0466718_067853 | 3300042617 | Bacteria | 3429 |
| 44 | Ga0466700_008918 | 3300042600 | Bacteria | 1463 |
| 45 | Ga0466700_140720 | 3300042600 | Bacteria | 1091 |
| 46 | Ga0466720_006464 | 3300042607 | Bacteria | 7243 |
| 47 | Ga0466720_077952 | 3300042607 | Bacteria | 14116 |
| 48 | Ga0466720_103059 | 3300042607 | Bacteria | 16991 |
| 49 | Ga0466698_018235 | 3300042610 | Bacteria | 17805 |
| 50 | Ga0264413_104122 | 3300024493 | Bacteria | 19869 |
| 51 | Ga0264413_113500 | 3300024493 | Unclassified | 946 |
| 52 | Ga0466695_263127 | 3300042595 | Bacteria | 5243 |
| 53 | Ga0466695_369155 | 3300042595 | Bacteria | 2449 |
| 54 | JGI24695J34938_10303612 | 3300002450 | Bacteria | 690 |
| 55 | Ga0466732_066996 | 3300042656 | Bacteria | 1778 |
| 56 | Ga0123353_10307408 | 3300010167 | Bacteria | 2416 |
| 57 | Ga0466712_311726 | 3300042614 | Bacteria | 1145 |
| 58 | Ga0466718_031913 | 3300042617 | Bacteria | 14989 |
| 59 | Ga0466718_130466 | 3300042617 | Bacteria | 2982 |
| 60 | Ga0466718_134779 | 3300042617 | Bacteria | 5095 |
| 61 | Ga0466718_136943 | 3300042617 | Bacteria | 1919 |
| 62 | Ga0466720_064108 | 3300042607 | Bacteria | 1149 |
| 63 | Ga0466720_138812 | 3300042607 | Bacteria | 2458 |
| 64 | Ga0466695_132722 | 3300042595 | Bacteria | 66949 |
| 65 | Ga0466704_493891 | 3300042643 | Bacteria | 6782 |
| 66 | AustNasuHG_c1000583 | 3300000089 | Bacteria | 12879 |
| 67 | FAAS_10000124 | 3300001880 | Bacteria | 1024 |
| 68 | JGI24695J34938_10060982 | 3300002450 | Unclassified | 1607 |
| 69 | Ga0466723_031610 | 3300042618 | Bacteria | 8261 |
| 70 | Ga0466720_012772 | 3300042607 | Bacteria | 14217 |
| 71 | Ga0466720_049114 | 3300042607 | Bacteria | 16312 |
| 72 | Ga0466720_069262 | 3300042607 | Bacteria | 3140 |
| 73 | Ga0466720_120978 | 3300042607 | Bacteria | 10959 |
| 74 | Ga0466720_141940 | 3300042607 | Bacteria | 17145 |
| 75 | Ga0466720_238508 | 3300042607 | Bacteria | 16615 |
| 76 | Ga0466698_453385 | 3300042610 | Bacteria | 1350 |
| 77 | Ga0264413_102757 | 3300024493 | Bacteria | 2399 |
| 78 | Ga0264413_132906 | 3300024493 | Bacteria | 1299 |
| 79 | Ga0415639_021707 | 3300038395 | Bacteria | 1706 |
| 80 | Ga0466699_001249 | 3300042597 | Bacteria | 1640 |
| 81 | Ga0466699_287251 | 3300042597 | Bacteria | 1417 |
| 82 | AustNasuHG_c1025081 | 3300000089 | Bacteria | 1879 |
| 83 | Ga0074263_103713 | 3300005485 | Bacteria | 2315 |
| 84 | Ga0466718_019465 | 3300042617 | Bacteria | 6251 |
| 85 | Ga0466718_069225 | 3300042617 | Unclassified | 2585 |
| 86 | Ga0466720_012068 | 3300042607 | Unclassified | 6117 |
| 87 | Ga0466720_094351 | 3300042607 | Bacteria | 6391 |
| 88 | Ga0466720_141139 | 3300042607 | Bacteria | 16659 |
| 89 | Ga0466720_180570 | 3300042607 | Bacteria | 10510 |
| 90 | Ga0466720_198236 | 3300042607 | Bacteria | 1026 |
| 91 | Ga0466698_174529 | 3300042610 | Bacteria | 2201 |
| 92 | Ga0466698_450903 | 3300042610 | Bacteria | 1484 |
| 93 | Ga0466693_154206 | 3300042592 | Bacteria | 1292 |
| 94 | Ga0466699_037021 | 3300042597 | Bacteria | 1000 |
| 95 | Ga0466699_161917 | 3300042597 | Bacteria | 2656 |
| 96 | Ga0466699_261362 | 3300042597 | Unclassified | 3801 |
| 97 | AustNasuHG_c1004273 | 3300000089 | Bacteria | 5125 |
| 98 | Ga0466732_152032 | 3300042656 | Bacteria | 16830 |
| 99 | Ga0466720_060904 | 3300042607 | Bacteria | 13154 |
| 100 | Ga0466720_071558 | 3300042607 | Bacteria | 5387 |
| 101 | Ga0466720_081254 | 3300042607 | Bacteria | 15096 |
| 102 | Ga0466720_214618 | 3300042607 | Bacteria | 3841 |
| 103 | Ga0264413_110074 | 3300024493 | Bacteria | 8088 |
| 104 | Ga0264413_111499 | 3300024493 | Bacteria | 1499 |
| 105 | Ga0466693_128816 | 3300042592 | Bacteria | 39215 |
| 106 | Ga0466699_100793 | 3300042597 | Bacteria | 1059 |
| 107 | Ga0466699_380533 | 3300042597 | Bacteria | 1102 |
| 108 | Ga0072940_1005614 | 3300005200 | Bacteria | 1485 |
| 109 | Ga0072941_1396207 | 3300005201 | Bacteria | 1445 |
| 110 | Ga0074263_105485 | 3300005485 | Bacteria | 1494 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01814 | Hemerythrin | Hemerythrin HHE cation binding domain | 34 | 148 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.