Protein Family IF05326

Metagenome Isolate
113 Members
22 Samples
109 Scaffolds
311.66 Avg Length

🧬 Representative Sequence

ID
3300042597|Ga0466699_201992|Ga0466699_201992_4925_5971
Length
335 aa
Sequence
MFDNAAVSGSRRRQIGIMPSSGGKLMLEVRNLSKEFLLSGGRRVQAVNGVSFTAKENETIGIVGESGCGKSTLGRLILRLLEPSGGKIFFRGEEISSINRRALGARRQEMQMIFQNPFASFNPKIRFETALMEVCLFYGMNVQEGRNRIEQLFADTGLSEDLLQRWPRELSGGQLQRLAIVRSLISEPSLLIADEPLSALDVSVQAQLLNLLRDLRKTRSMLMMFISHDMTVVEYFCDRVAVMYLGRIMEIIPAPVLSGATASPGLSGFLHPYTRALRASSPRLDAFKNDSRQKNEPVMVKGEPSNPLTTFKGCPFAPRCTETESPGHWISCHHG

📊 Sample Types

Isolate 3.5%
Metagenome 96.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 80.0%
Unclassified 20.0%

🌳 Taxonomy

Archaea 0
Bacteria 110
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
2 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
3 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
4 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
5 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
6 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
9 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
21 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
22 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_080173 3300042614 Bacteria 18567
2 Ga0466712_093878 3300042614 Bacteria 4081
3 Ga0466720_000790 3300042607 Bacteria 10899
4 Ga0466720_109204 3300042607 Bacteria 13558
5 Ga0466720_140148 3300042607 Bacteria 44679
6 Ga0264413_100827 3300024493 Bacteria 26484
7 Ga0264413_144042 3300024493 Bacteria 1564
8 Ga0466699_032271 3300042597 Bacteria 2400
9 Ga0466699_090439 3300042597 Bacteria 22019
10 JGI24695J34938_10009845 3300002450 Bacteria 5284
11 JGI24695J34938_10031190 3300002450 Bacteria 2476
12 Ga0072941_1068167 3300005201 Bacteria 7931
13 Ga0466732_344263 3300042656 Bacteria 29680
14 Ga0123357_10406292 3300009784 Bacteria 1233
15 Ga0466712_062576 3300042614 Bacteria 23115
16 Ga0466718_007597 3300042617 Bacteria 24528
17 Ga0466718_017480 3300042617 Bacteria 3402
18 Ga0466720_023940 3300042607 Bacteria 11136
19 Ga0466720_089845 3300042607 Bacteria 10496
20 Ga0466720_175055 3300042607 Bacteria 9795
21 Ga0466698_352955 3300042610 Bacteria 1827
22 Ga0264413_110372 3300024493 Bacteria 11776
23 Ga0466699_002532 3300042597 Bacteria 37404
24 Ga0466699_061154 3300042597 Bacteria 1988
25 Ga0466699_351348 3300042597 Bacteria 43572
26 Ga0466699_386158 3300042597 Bacteria 2376
27 JGI24698J34947_10019980 3300002449 Bacteria 3610
28 Ga0072940_1036334 3300005200 Bacteria 1608
29 Ga0072941_1004854 3300005201 Bacteria 7258
30 Ga0123354_10232104 3300010882 Bacteria 1926
31 Ga0466712_032159 3300042614 Bacteria 4001
32 Ga0466718_003708 3300042617 Bacteria 2740
33 Ga0466718_112706 3300042617 Bacteria 35886
34 Ga0466720_036072 3300042607 Bacteria 3573
35 Ga0466720_215415 3300042607 Bacteria 2444
36 Ga0466698_431349 3300042610 Bacteria 1187
37 Ga0466699_170782 3300042597 Bacteria 13209
38 AustNasuHG_c1001190 3300000089 Bacteria 9362
39 JGI24698J34947_10003601 3300002449 Bacteria 8412
40 JGI24698J34947_10004576 3300002449 Bacteria 7537
41 JGI24698J34947_10031463 3300002449 Bacteria 2792
42 JGI24695J34938_10031132 3300002450 Bacteria 2479
43 Ga0466732_215724 3300042656 Unclassified 1319
44 Ga0123357_10081903 3300009784 Bacteria 4240
45 Ga0466712_027961 3300042614 Bacteria 4878
46 Ga0466712_320829 3300042614 Bacteria 12922
47 Ga0466718_116141 3300042617 Bacteria 3053
48 Ga0466720_082440 3300042607 Bacteria 2416
49 Ga0466720_107188 3300042607 Bacteria 12748
50 Ga0264413_104415 3300024493 Bacteria 15017
51 Ga0264413_125827 3300024493 Bacteria 2019
52 Ga0466699_072139 3300042597 Bacteria 8401
53 Ga0466699_156310 3300042597 Bacteria 3927
54 AustNasuHG_c1015423 3300000089 Bacteria 2577
55 Ga0466712_228791 3300042614 Bacteria 11782
56 Ga0466718_105899 3300042617 Bacteria 13365
57 Ga0466720_004308 3300042607 Bacteria 2913
58 Ga0466698_355393 3300042610 Bacteria 1312
59 Ga0264413_113872 3300024493 Bacteria 9238
60 Ga0264413_125380 3300024493 Bacteria 1938
61 Ga0466699_104476 3300042597 Bacteria 12748
62 AustNasuHG_c1012092 3300000089 Bacteria 2983
63 JGI24698J34947_10008062 3300002449 Bacteria 5781
64 JGI24698J34947_10014835 3300002449 Bacteria 4243
65 JGI24695J34938_10002048 3300002450 Bacteria 15905
66 JGI24695J34938_10009693 3300002450 Bacteria 5337
67 Ga0466732_074603 3300042656 Bacteria 3691
68 Ga0466712_062217 3300042614 Bacteria 5520
69 Ga0466712_065462 3300042614 Bacteria 2107
70 Ga0466712_198178 3300042614 Bacteria 1753
71 Ga0466712_240939 3300042614 Bacteria 4928
72 Ga0466720_159810 3300042607 Bacteria 6946
73 Ga0264413_100824 3300024493 Bacteria 4464
74 Ga0264413_101328 3300024493 Bacteria 17843
75 Ga0466694_051100 3300042594 Bacteria 6970
76 JGI24698J34947_10002514 3300002449 Bacteria 9896
77 JGI24702J35022_10003992 3300002462 Bacteria 8853
78 Ga0074263_109555 3300005485 Unclassified 2256
79 Ga0466712_124231 3300042614 Bacteria 3293
80 Ga0466712_245057 3300042614 Bacteria 5343
81 Ga0466712_321724 3300042614 Bacteria 1853
82 Ga0466718_011848 3300042617 Bacteria 8252
83 Ga0466718_041795 3300042617 Bacteria 4933
84 Ga0466718_058590 3300042617 Bacteria 67835
85 Ga0466718_125883 3300042617 Bacteria 1917
86 Ga0466720_028525 3300042607 Bacteria 4891
87 Ga0264413_108985 3300024493 Bacteria 10570
88 Ga0466699_201992 3300042597 Bacteria 12240
89 Ga0466699_397737 3300042597 Bacteria 1095
90 JGI24698J34947_10004358 3300002449 Bacteria 7698
91 JGI24698J34947_10040913 3300002449 Bacteria 2390
92 JGI24695J34938_10001238 3300002450 Bacteria 22473
93 Ga0072941_1042880 3300005201 Bacteria 8907
94 Ga0466712_160819 3300042614 Bacteria 9742
95 Ga0466718_074643 3300042617 Bacteria 5679
96 Ga0466720_001948 3300042607 Bacteria 13369
97 Ga0466720_140503 3300042607 Bacteria 6298
98 Ga0466698_386467 3300042610 Bacteria 3191
99 Ga0264413_102353 3300024493 Bacteria 21492
100 Ga0264413_112549 3300024493 Bacteria 3825
101 Ga0264413_125781 3300024493 Bacteria 11339
102 Ga0466693_044972 3300042592 Bacteria 7984
103 Ga0466699_182867 3300042597 Bacteria 3404
104 Ga0466699_323729 3300042597 Unclassified 1711
105 JGI24698J34947_10003090 3300002449 Bacteria 9014
106 JGI24698J34947_10003970 3300002449 Bacteria 8046
107 JGI24698J34947_10035874 3300002449 Bacteria 2585
108 JGI24698J34947_10062146 3300002449 Bacteria 1835
109 JGI24695J34938_10000920 3300002450 Bacteria 26983

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 48 197 0.91
PF08352 oligo_HPY Oligopeptide/dipeptide transporter, C-terminal region 269 323 0.77

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.