Protein Family IF05325
Metagenome
Metatranscriptome
Isolate
112
Members
29
Samples
108
Scaffolds
180.68
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_199152|Ga0466699_199152_491_1129
- Length
- 212 aa
- Sequence
- VLHGNRWAGAFITTFGDKAGEGFLCLKALVEPLKAVSDVLFGYSAAHRLEVILRDAIDVQNEEKNLPRSTRRNTEEEEKDIKTPCNSKLSVGQQSSVVKNSCEYAIRFICLLVEKNQFRNIDMILQKIEEALDAKNGILSVSVESASPLDDVFEGELRRRIIAQTGAADLKMNTLVVPSLLGGYRLRIGGYYVDASLKGQIEKMKADLEAGI
Sample Types
Isolate
3.6%
Metagenome
94.6%
MAG
0.0%
Metatranscriptome
1.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
80.0%
Unclassified
16.0%
Rhinotermitidae
4.0%
Taxonomy
Archaea
0
Bacteria
95
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 21 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 24 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 25 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 26 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 27 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 28 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10007173 | 3300002449 | Bacteria | 6126 |
| 2 | JGI24698J34947_10194922 | 3300002449 | Bacteria | 798 |
| 3 | JGI24698J34947_10213833 | 3300002449 | Unclassified | 745 |
| 4 | Ga0072940_1029610 | 3300005200 | Bacteria | 2216 |
| 5 | Ga0072941_1116176 | 3300005201 | Bacteria | 4533 |
| 6 | Ga0072941_1163090 | 3300005201 | Bacteria | 1472 |
| 7 | Ga0466699_072543 | 3300042597 | Bacteria | 9594 |
| 8 | Ga0466699_199818 | 3300042597 | Bacteria | 2897 |
| 9 | Ga0466699_203217 | 3300042597 | Bacteria | 1627 |
| 10 | Ga0466712_031039 | 3300042614 | Bacteria | 1366 |
| 11 | Ga0466712_221230 | 3300042614 | Bacteria | 1295 |
| 12 | Ga0466702_216133 | 3300042635 | Bacteria | 1510 |
| 13 | JGI24698J34947_10003213 | 3300002449 | Bacteria | 8856 |
| 14 | JGI24698J34947_10077107 | 3300002449 | Bacteria | 1577 |
| 15 | JGI24698J34947_10219436 | 3300002449 | Unclassified | 730 |
| 16 | JGI24695J34938_10001187 | 3300002450 | Bacteria | 23128 |
| 17 | Ga0072941_1160190 | 3300005201 | Bacteria | 2474 |
| 18 | Ga0074263_105923 | 3300005485 | Bacteria | 1161 |
| 19 | Ga0466694_030111 | 3300042594 | Bacteria | 4386 |
| 20 | Ga0466695_330656 | 3300042595 | Bacteria | 23944 |
| 21 | Ga0466699_004859 | 3300042597 | Bacteria | 1427 |
| 22 | Ga0466699_199152 | 3300042597 | Bacteria | 1474 |
| 23 | Ga0466732_395103 | 3300042656 | Bacteria | 4949 |
| 24 | Ga0466712_029559 | 3300042614 | Bacteria | 21198 |
| 25 | Ga0466712_082900 | 3300042614 | Unclassified | 1189 |
| 26 | Ga0123353_10137040 | 3300010167 | Bacteria | 3925 |
| 27 | Ga0466702_089787 | 3300042635 | Bacteria | 25457 |
| 28 | Ga0466702_422062 | 3300042635 | Bacteria | 1362 |
| 29 | JGI24698J34947_10002354 | 3300002449 | Bacteria | 10172 |
| 30 | JGI24698J34947_10195409 | 3300002449 | Unclassified | 797 |
| 31 | JGI24702J35022_10208769 | 3300002462 | Bacteria | 1120 |
| 32 | Ga0072941_1083446 | 3300005201 | Unclassified | 1802 |
| 33 | Ga0072941_1110635 | 3300005201 | Bacteria | 1349 |
| 34 | Ga0072941_1129581 | 3300005201 | Bacteria | 1393 |
| 35 | Ga0223675_1000119 | 3300021237 | Bacteria | 1605 |
| 36 | Ga0255809_1007363 | 3300022820 | Bacteria | 1519 |
| 37 | Ga0264413_107518 | 3300024493 | Bacteria | 40797 |
| 38 | Ga0466694_319436 | 3300042594 | Bacteria | 51857 |
| 39 | Ga0466699_122625 | 3300042597 | Bacteria | 28030 |
| 40 | Ga0466699_150298 | 3300042597 | Bacteria | 4807 |
| 41 | Ga0466699_260426 | 3300042597 | Bacteria | 1599 |
| 42 | Ga0466699_281171 | 3300042597 | Bacteria | 25408 |
| 43 | Ga0466699_307329 | 3300042597 | Bacteria | 1513 |
| 44 | Ga0466699_377805 | 3300042597 | Bacteria | 1144 |
| 45 | Ga0466699_379025 | 3300042597 | Bacteria | 2443 |
| 46 | Ga0466698_102331 | 3300042610 | Bacteria | 1586 |
| 47 | Ga0466698_190532 | 3300042610 | Bacteria | 1183 |
| 48 | Ga0466712_069830 | 3300042614 | Bacteria | 1717 |
| 49 | Ga0466712_101071 | 3300042614 | Bacteria | 19503 |
| 50 | Ga0466712_208848 | 3300042614 | Bacteria | 2585 |
| 51 | JGI24698J34947_10063910 | 3300002449 | Bacteria | 1802 |
| 52 | JGI24698J34947_10111220 | 3300002449 | Bacteria | 1209 |
| 53 | JGI24698J34947_10153741 | 3300002449 | Bacteria | 952 |
| 54 | JGI24698J34947_10260564 | 3300002449 | Unclassified | 643 |
| 55 | JGI24697J35500_11240939 | 3300002507 | Unclassified | 2233 |
| 56 | Ga0072941_1001530 | 3300005201 | Bacteria | 8298 |
| 57 | Ga0072941_1011779 | 3300005201 | Bacteria | 29388 |
| 58 | Ga0072941_1066549 | 3300005201 | Bacteria | 2563 |
| 59 | Ga0466694_081600 | 3300042594 | Bacteria | 1195 |
| 60 | Ga0466694_122864 | 3300042594 | Unclassified | 1124 |
| 61 | Ga0466699_026980 | 3300042597 | Bacteria | 1996 |
| 62 | Ga0466699_046549 | 3300042597 | Bacteria | 2906 |
| 63 | Ga0466699_092225 | 3300042597 | Bacteria | 1870 |
| 64 | Ga0466699_177215 | 3300042597 | Bacteria | 13885 |
| 65 | Ga0466712_076036 | 3300042614 | Bacteria | 1491 |
| 66 | Ga0466702_227375 | 3300042635 | Bacteria | 4354 |
| 67 | Ga0466702_320554 | 3300042635 | Bacteria | 1940 |
| 68 | JGI24698J34947_10056695 | 3300002449 | Bacteria | 1946 |
| 69 | JGI24695J34938_10000589 | 3300002450 | Bacteria | 35025 |
| 70 | JGI24695J34938_10253329 | 3300002450 | Unclassified | 748 |
| 71 | Ga0072941_1167905 | 3300005201 | Bacteria | 793 |
| 72 | Ga0466699_029208 | 3300042597 | Bacteria | 3767 |
| 73 | Ga0466712_163040 | 3300042614 | Unclassified | 1354 |
| 74 | Ga0466718_126450 | 3300042617 | Bacteria | 1051 |
| 75 | Ga0123356_10015416 | 3300010049 | Bacteria | 7328 |
| 76 | Ga0466702_200444 | 3300042635 | Bacteria | 2111 |
| 77 | FAAS_10095050 | 3300001880 | Unclassified | 580 |
| 78 | JGI24698J34947_10174345 | 3300002449 | Unclassified | 866 |
| 79 | JGI24702J35022_10003632 | 3300002462 | Bacteria | 9294 |
| 80 | Ga0072941_1003951 | 3300005201 | Bacteria | 12993 |
| 81 | Ga0072941_1110828 | 3300005201 | Bacteria | 2551 |
| 82 | Ga0072941_1208142 | 3300005201 | Unclassified | 1151 |
| 83 | Ga0466699_180190 | 3300042597 | Bacteria | 9824 |
| 84 | Ga0466699_260703 | 3300042597 | Bacteria | 1849 |
| 85 | Ga0466733_077565 | 3300042659 | Bacteria | 3631 |
| 86 | Ga0466700_320773 | 3300042600 | Bacteria | 3171 |
| 87 | Ga0466712_012259 | 3300042614 | Bacteria | 2691 |
| 88 | Ga0123356_10001171 | 3300010049 | Bacteria | 29024 |
| 89 | Nasutiter_Contig00229 | 2030936001 | Bacteria | 1037 |
| 90 | JGI24698J34947_10203730 | 3300002449 | Unclassified | 772 |
| 91 | Ga0072941_1024437 | 3300005201 | Unclassified | 2150 |
| 92 | Ga0466699_027020 | 3300042597 | Bacteria | 5752 |
| 93 | Ga0466699_278090 | 3300042597 | Bacteria | 4669 |
| 94 | Ga0466700_198840 | 3300042600 | Bacteria | 2394 |
| 95 | Ga0466718_051798 | 3300042617 | Bacteria | 1597 |
| 96 | Ga0466718_065163 | 3300042617 | Bacteria | 5856 |
| 97 | Ga0466718_082599 | 3300042617 | Bacteria | 2136 |
| 98 | Ga0466702_023615 | 3300042635 | Bacteria | 14619 |
| 99 | JGI24698J34947_10178956 | 3300002449 | Unclassified | 850 |
| 100 | Ga0264413_114187 | 3300024493 | Bacteria | 4212 |
| 101 | Ga0264413_114188 | 3300024493 | Unclassified | 1574 |
| 102 | Ga0466699_002723 | 3300042597 | Bacteria | 13245 |
| 103 | Ga0466699_120102 | 3300042597 | Bacteria | 2100 |
| 104 | Ga0466699_280968 | 3300042597 | Bacteria | 14109 |
| 105 | Ga0466722_043214 | 3300042609 | Bacteria | 2028 |
| 106 | Ga0466712_169423 | 3300042614 | Bacteria | 10051 |
| 107 | Ga0466718_143859 | 3300042617 | Bacteria | 1083 |
| 108 | Ga0466702_192803 | 3300042635 | Bacteria | 1714 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00213 | OSCP | ATP synthase delta (OSCP) subunit | 90 | 208 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.