Protein Family IF05316
Metagenome
Metatranscriptome
Isolate
122
Members
25
Samples
116
Scaffolds
316.53
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_169246|Ga0466699_169246_7792_8784
- Length
- 330 aa
- Sequence
- MKHVFVFDLGAFAERQFAFASHGMPRLLQQEKPDVIQDRIGQYFRTQVKPDWSVQQSRFPRDAIGIIQKEADEVKDNDTVRVYAIGGDEILFDCLNGVAGLPRAELAAVPYGRANDFIRAFEGGRPEKFRNIPTLVAAPTVPTDIIDTGNNFAMIGCAVGFSPAAAVKLRNWKKSRSRLSRFFIVDRILSFLSNLTTGFNKKITARSYKITIDDQDYSGNYSLIIVSNCPYYGGNRIGVVGAIPDDGLLDVALFKSAGPLRTFLSLGIYSRKKKPSNCTLLKAKKISVQSDEPVWIQMDTEFLQDSSINFEVIPGAVQVVAVDSLSYQKQ
Sample Types
Isolate
4.9%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
73.9%
Unclassified
21.7%
Rhinotermitidae
4.3%
Taxonomy
Archaea
1
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 2 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 3 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 12 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 13 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 16 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 20 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 21 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 22 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 23 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 24 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 25 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_010305 | 3300038395 | Bacteria | 27350 |
| 2 | Ga0466694_051046 | 3300042594 | Bacteria | 57740 |
| 3 | Ga0466694_195518 | 3300042594 | Bacteria | 20552 |
| 4 | JGI24698J34947_10000302 | 3300002449 | Bacteria | 21573 |
| 5 | JGI24698J34947_10002329 | 3300002449 | Bacteria | 10213 |
| 6 | JGI24698J34947_10017388 | 3300002449 | Bacteria | 3897 |
| 7 | JGI24698J34947_10023385 | 3300002449 | Bacteria | 3307 |
| 8 | Ga0072941_1000463 | 3300005201 | Bacteria | 8333 |
| 9 | Ga0072941_1014606 | 3300005201 | Bacteria | 1473 |
| 10 | Ga0072941_1038784 | 3300005201 | Bacteria | 6212 |
| 11 | Ga0466720_021133 | 3300042607 | Unclassified | 11357 |
| 12 | Ga0466720_067705 | 3300042607 | Bacteria | 18756 |
| 13 | Ga0466694_145773 | 3300042594 | Bacteria | 17015 |
| 14 | Ga0466699_043720 | 3300042597 | Bacteria | 24375 |
| 15 | Ga0466712_072637 | 3300042614 | Bacteria | 1550 |
| 16 | Ga0123356_10000532 | 3300010049 | Bacteria | 42369 |
| 17 | JGI24698J34947_10002549 | 3300002449 | Bacteria | 9834 |
| 18 | JGI24698J34947_10004256 | 3300002449 | Bacteria | 7785 |
| 19 | JGI24698J34947_10037790 | 3300002449 | Bacteria | 2506 |
| 20 | JGI24698J34947_10039702 | 3300002449 | Unclassified | 2435 |
| 21 | JGI24695J34938_10024659 | 3300002450 | Unclassified | 2886 |
| 22 | Ga0072940_1037609 | 3300005200 | Unclassified | 2131 |
| 23 | Ga0072941_1228386 | 3300005201 | Bacteria | 1726 |
| 24 | Ga0466720_011340 | 3300042607 | Bacteria | 9787 |
| 25 | Ga0466732_003769 | 3300042656 | Bacteria | 18416 |
| 26 | Ga0466732_228781 | 3300042656 | Bacteria | 3098 |
| 27 | Ga0264413_104061 | 3300024493 | Bacteria | 24138 |
| 28 | Ga0264413_107706 | 3300024493 | Bacteria | 7407 |
| 29 | Ga0466693_127498 | 3300042592 | Unclassified | 2327 |
| 30 | Ga0466699_250622 | 3300042597 | Bacteria | 4455 |
| 31 | Ga0466712_233590 | 3300042614 | Bacteria | 3084 |
| 32 | Ga0123353_10691079 | 3300010167 | Bacteria | 1434 |
| 33 | AustNasuHG_c1002897 | 3300000089 | Bacteria | 6195 |
| 34 | AustNasuHG_c1030193 | 3300000089 | Bacteria | 1566 |
| 35 | JGI24695J34938_10001657 | 3300002450 | Bacteria | 18515 |
| 36 | Ga0072940_1039577 | 3300005200 | Bacteria | 7417 |
| 37 | Ga0466720_028106 | 3300042607 | Bacteria | 24586 |
| 38 | Ga0264413_101076 | 3300024493 | Bacteria | 2596 |
| 39 | Ga0264413_109869 | 3300024493 | Bacteria | 9142 |
| 40 | Ga0415639_038403 | 3300038395 | Bacteria | 3964 |
| 41 | Ga0466712_079997 | 3300042614 | Bacteria | 9721 |
| 42 | AustNasuHG_c1000066 | 3300000089 | Bacteria | 28642 |
| 43 | JGI24698J34947_10001340 | 3300002449 | Bacteria | 12954 |
| 44 | JGI24698J34947_10009685 | 3300002449 | Bacteria | 5281 |
| 45 | JGI24698J34947_10022104 | 3300002449 | Bacteria | 3413 |
| 46 | Ga0072940_1003187 | 3300005200 | Bacteria | 5939 |
| 47 | Ga0072940_1030110 | 3300005200 | Bacteria | 16965 |
| 48 | Ga0072940_1032077 | 3300005200 | Bacteria | 2020 |
| 49 | Ga0072940_1044470 | 3300005200 | Bacteria | 2198 |
| 50 | Ga0072940_1073465 | 3300005200 | Bacteria | 1509 |
| 51 | Ga0072940_1171558 | 3300005200 | Bacteria | 1883 |
| 52 | Ga0072941_1015353 | 3300005201 | Unclassified | 11529 |
| 53 | Ga0072941_1038783 | 3300005201 | Bacteria | 6369 |
| 54 | Ga0466720_137070 | 3300042607 | Bacteria | 34404 |
| 55 | Ga0466720_191129 | 3300042607 | Bacteria | 6728 |
| 56 | Ga0466721_188709 | 3300042608 | Bacteria | 2494 |
| 57 | Ga0466732_148630 | 3300042656 | Bacteria | 15820 |
| 58 | Ga0466694_011506 | 3300042594 | Bacteria | 9938 |
| 59 | Ga0466699_013441 | 3300042597 | Bacteria | 17996 |
| 60 | Ga0466699_122315 | 3300042597 | Bacteria | 38581 |
| 61 | Ga0466699_226530 | 3300042597 | Bacteria | 2389 |
| 62 | Ga0466712_052591 | 3300042614 | Bacteria | 19320 |
| 63 | Ga0466718_040373 | 3300042617 | Bacteria | 43603 |
| 64 | Ga0123356_10000073 | 3300010049 | Bacteria | 106706 |
| 65 | Ga0123356_10606926 | 3300010049 | Bacteria | 1259 |
| 66 | Ga0123353_10274883 | 3300010167 | Archaea | 2592 |
| 67 | AustNasuHG_c1001144 | 3300000089 | Bacteria | 9560 |
| 68 | AustNasuHG_c1001910 | 3300000089 | Bacteria | 7507 |
| 69 | AustNasuHG_c1002594 | 3300000089 | Bacteria | 6526 |
| 70 | JGI24698J34947_10003430 | 3300002449 | Bacteria | 8604 |
| 71 | JGI24698J34947_10006720 | 3300002449 | Bacteria | 6318 |
| 72 | JGI24695J34938_10000220 | 3300002450 | Bacteria | 54504 |
| 73 | JGI24695J34938_10000258 | 3300002450 | Bacteria | 51430 |
| 74 | JGI24695J34938_10000621 | 3300002450 | Bacteria | 33808 |
| 75 | Ga0072940_1003188 | 3300005200 | Bacteria | 6321 |
| 76 | Ga0072941_1008255 | 3300005201 | Bacteria | 10283 |
| 77 | Ga0466720_172890 | 3300042607 | Bacteria | 1782 |
| 78 | Ga0466720_199297 | 3300042607 | Bacteria | 6514 |
| 79 | Ga0255786_1003032 | 3300022815 | Bacteria | 4229 |
| 80 | Ga0264413_121972 | 3300024493 | Bacteria | 3577 |
| 81 | Ga0466694_341171 | 3300042594 | Bacteria | 2964 |
| 82 | Ga0466699_077150 | 3300042597 | Bacteria | 3505 |
| 83 | Ga0466699_432863 | 3300042597 | Bacteria | 9292 |
| 84 | AustNasuHG_c1006235 | 3300000089 | Bacteria | 4260 |
| 85 | AustNasuHG_c1037327 | 3300000089 | Bacteria | 1243 |
| 86 | JGI24698J34947_10000452 | 3300002449 | Bacteria | 19069 |
| 87 | JGI24698J34947_10005093 | 3300002449 | Bacteria | 7200 |
| 88 | JGI24698J34947_10007284 | 3300002449 | Bacteria | 6077 |
| 89 | Ga0072940_1008651 | 3300005200 | Bacteria | 15512 |
| 90 | Ga0072941_1051032 | 3300005201 | Bacteria | 5189 |
| 91 | Ga0466720_052644 | 3300042607 | Bacteria | 4675 |
| 92 | Ga0466720_168076 | 3300042607 | Bacteria | 6780 |
| 93 | Ga0466699_013842 | 3300042597 | Bacteria | 17302 |
| 94 | Ga0466699_294228 | 3300042597 | Bacteria | 3035 |
| 95 | Ga0466712_061615 | 3300042614 | Bacteria | 40670 |
| 96 | Ga0466712_118761 | 3300042614 | Bacteria | 9798 |
| 97 | Ga0466712_293443 | 3300042614 | Bacteria | 21258 |
| 98 | JGI24698J34947_10000588 | 3300002449 | Bacteria | 17295 |
| 99 | JGI24698J34947_10016383 | 3300002449 | Bacteria | 4023 |
| 100 | Ga0072941_1092796 | 3300005201 | Bacteria | 5225 |
| 101 | Ga0466720_038689 | 3300042607 | Bacteria | 11105 |
| 102 | Ga0466720_093758 | 3300042607 | Bacteria | 5320 |
| 103 | Ga0466720_106727 | 3300042607 | Unclassified | 6246 |
| 104 | Ga0466720_109497 | 3300042607 | Bacteria | 28074 |
| 105 | Ga0466722_027454 | 3300042609 | Bacteria | 32114 |
| 106 | Ga0264413_102820 | 3300024493 | Bacteria | 21633 |
| 107 | Ga0264413_105632 | 3300024493 | Bacteria | 5321 |
| 108 | Ga0415639_097151 | 3300038395 | Bacteria | 2596 |
| 109 | Ga0466699_161858 | 3300042597 | Bacteria | 10619 |
| 110 | Ga0466699_169246 | 3300042597 | Bacteria | 14078 |
| 111 | Ga0466699_175844 | 3300042597 | Bacteria | 5119 |
| 112 | Ga0466712_005899 | 3300042614 | Bacteria | 24210 |
| 113 | Ga0123353_10053835 | 3300010167 | Bacteria | 6432 |
| 114 | JGI24698J34947_10078871 | 3300002449 | Bacteria | 1552 |
| 115 | Ga0466731_410645 | 3300042622 | Bacteria | 10338 |
| 116 | Ga0466720_039585 | 3300042607 | Bacteria | 24073 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00781 | GO:0016301 | kinase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.