Protein Family IF05301
Metagenome
Isolate
178
Members
45
Samples
172
Scaffolds
281.31
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_127162|Ga0466699_127162_202_1179
- Length
- 325 aa
- Sequence
- MLVLIRIIMATSAPKYTRIQIEAITTPTTEFFFEFFARNIKLLYTFPPFSARIIGMNLRESSLPAGWYPRNPDEIGRFLSGMERGSGRAAIAPHAGWRFSGKIAAAATASLGMDIDTLAVIGGHLPAGYPTLFAMEDSVSTPLGPMPVHAALRAVLVKELDGHEDAFPDNTVEVLLPMARYFFPDASLLWLRLPAEKSSFDAGKTIAAAALNLGCKLAVLGSSDLTHYGPNYGFTPQGTGPQALQWMRDTNDRRFIDAVLSGDPAAVLERAEKDRSSCSAGAVLGAMGFASAQGASSARLIQYGTSADTMDADSFVGYAAIAFPG
Sample Types
Isolate
3.4%
Metagenome
96.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.2%
Kalotermitidae
30.2%
Unclassified
16.3%
Rhinotermitidae
7.0%
Termopsidae
4.7%
Blaberidae
2.3%
Hodotermitidae
2.3%
Taxonomy
Archaea
1
Bacteria
174
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 11 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 18 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 19 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 2228664002 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3a from Florida, USA | Metagenome | Termitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_105325 | 3300042600 | Bacteria | 1320 |
| 2 | Ga0466716_498917 | 3300042605 | Bacteria | 1701 |
| 3 | Ga0466720_007399 | 3300042607 | Bacteria | 4580 |
| 4 | Ga0466720_020352 | 3300042607 | Bacteria | 5742 |
| 5 | Ga0466722_208764 | 3300042609 | Bacteria | 3733 |
| 6 | Ga0466732_117448 | 3300042656 | Bacteria | 1275 |
| 7 | Ga0466732_356690 | 3300042656 | Bacteria | 7352 |
| 8 | Ga0466726_441464 | 3300042619 | Bacteria | 2132 |
| 9 | JGI24698J34947_10002083 | 3300002449 | Bacteria | 10700 |
| 10 | JGI24698J34947_10006058 | 3300002449 | Bacteria | 6641 |
| 11 | JGI24702J35022_10040329 | 3300002462 | Bacteria | 2490 |
| 12 | Ga0264413_103197 | 3300024493 | Bacteria | 5262 |
| 13 | Ga0466699_075484 | 3300042597 | Bacteria | 10304 |
| 14 | Ga0466699_154742 | 3300042597 | Bacteria | 9949 |
| 15 | Ga0466719_458128 | 3300042606 | Bacteria | 4027 |
| 16 | Ga0466705_168708 | 3300042612 | Bacteria | 15467 |
| 17 | Ga0466705_485305 | 3300042612 | Bacteria | 2804 |
| 18 | Ga0466712_126726 | 3300042614 | Bacteria | 3373 |
| 19 | Ga0466711_197597 | 3300042615 | Bacteria | 20853 |
| 20 | Ga0466718_043233 | 3300042617 | Bacteria | 14865 |
| 21 | Ga0466718_091888 | 3300042617 | Bacteria | 2498 |
| 22 | Ga0466723_053830 | 3300042618 | Bacteria | 8166 |
| 23 | JGI24698J34947_10044715 | 3300002449 | Bacteria | 2264 |
| 24 | Ga0466709_047824 | 3300042648 | Bacteria | 2088 |
| 25 | Ga0466708_165936 | 3300042652 | Unclassified | 1614 |
| 26 | Ga0466708_244761 | 3300042652 | Bacteria | 3290 |
| 27 | Ga0466708_467939 | 3300042652 | Bacteria | 6432 |
| 28 | Ga0264413_127389 | 3300024493 | Bacteria | 1760 |
| 29 | Ga0466694_159625 | 3300042594 | Bacteria | 2318 |
| 30 | Ga0466699_204718 | 3300042597 | Bacteria | 1123 |
| 31 | Ga0466706_205209 | 3300042599 | Bacteria | 2868 |
| 32 | Ga0466719_099995 | 3300042606 | Bacteria | 30212 |
| 33 | Ga0466720_033636 | 3300042607 | Bacteria | 19556 |
| 34 | Ga0466705_255983 | 3300042612 | Bacteria | 1857 |
| 35 | Ga0466732_118319 | 3300042656 | Bacteria | 5409 |
| 36 | Ga0466712_042388 | 3300042614 | Bacteria | 1089 |
| 37 | Ga0466712_075270 | 3300042614 | Bacteria | 7691 |
| 38 | Ga0466712_185316 | 3300042614 | Bacteria | 1834 |
| 39 | Ga0466711_121475 | 3300042615 | Bacteria | 27728 |
| 40 | Ga0466715_320405 | 3300042616 | Bacteria | 3062 |
| 41 | Ga0466718_074071 | 3300042617 | Bacteria | 2541 |
| 42 | Ga0466723_148841 | 3300042618 | Bacteria | 18796 |
| 43 | Ga0123356_10223007 | 3300010049 | Bacteria | 1943 |
| 44 | JGI24695J34938_10008927 | 3300002450 | Bacteria | 5650 |
| 45 | Ga0072940_1023820 | 3300005200 | Bacteria | 5234 |
| 46 | Ga0072941_1007689 | 3300005201 | Bacteria | 10058 |
| 47 | Ga0072941_1007692 | 3300005201 | Archaea | 2335 |
| 48 | Ga0466703_007936 | 3300042636 | Bacteria | 2878 |
| 49 | Ga0264413_122520 | 3300024493 | Bacteria | 9334 |
| 50 | Ga0466690_014403 | 3300042590 | Bacteria | 3931 |
| 51 | Ga0466692_151515 | 3300042591 | Bacteria | 25092 |
| 52 | Ga0466699_114365 | 3300042597 | Bacteria | 18005 |
| 53 | Ga0466699_236052 | 3300042597 | Unclassified | 1347 |
| 54 | Ga0466699_267011 | 3300042597 | Bacteria | 5079 |
| 55 | Ga0466699_268323 | 3300042597 | Bacteria | 30824 |
| 56 | Ga0466707_197977 | 3300042601 | Bacteria | 2124 |
| 57 | Ga0466719_159558 | 3300042606 | Bacteria | 30542 |
| 58 | Ga0466719_383414 | 3300042606 | Bacteria | 5820 |
| 59 | Ga0466720_008518 | 3300042607 | Bacteria | 19922 |
| 60 | Ga0466720_048845 | 3300042607 | Bacteria | 5904 |
| 61 | Ga0466720_053586 | 3300042607 | Bacteria | 5590 |
| 62 | Ga0466698_350466 | 3300042610 | Bacteria | 1513 |
| 63 | Ga0466705_019109 | 3300042612 | Bacteria | 3335 |
| 64 | Ga0466705_046515 | 3300042612 | Bacteria | 21587 |
| 65 | Ga0466712_134322 | 3300042614 | Bacteria | 5847 |
| 66 | Ga0466715_035589 | 3300042616 | Bacteria | 6044 |
| 67 | Ga0466718_118289 | 3300042617 | Bacteria | 4051 |
| 68 | Ga0466718_163999 | 3300042617 | Bacteria | 16130 |
| 69 | Ga0466726_137695 | 3300042619 | Bacteria | 2252 |
| 70 | JGI24698J34947_10002867 | 3300002449 | Bacteria | 9355 |
| 71 | JGI24698J34947_10015302 | 3300002449 | Bacteria | 4176 |
| 72 | Ga0072940_1024875 | 3300005200 | Bacteria | 3940 |
| 73 | Ga0072941_1007690 | 3300005201 | Bacteria | 2441 |
| 74 | Ga0466702_337300 | 3300042635 | Bacteria | 13720 |
| 75 | Ga0466690_240952 | 3300042590 | Bacteria | 3769 |
| 76 | Ga0466694_127418 | 3300042594 | Bacteria | 8996 |
| 77 | Ga0466699_130690 | 3300042597 | Bacteria | 7400 |
| 78 | Ga0466699_200099 | 3300042597 | Bacteria | 2091 |
| 79 | Ga0466699_263768 | 3300042597 | Bacteria | 7427 |
| 80 | Ga0466720_068435 | 3300042607 | Bacteria | 10011 |
| 81 | Ga0466720_085594 | 3300042607 | Bacteria | 4199 |
| 82 | Ga0466732_181817 | 3300042656 | Bacteria | 2354 |
| 83 | Ga0466732_224357 | 3300042656 | Bacteria | 2049 |
| 84 | Ga0466712_130107 | 3300042614 | Bacteria | 2010 |
| 85 | Ga0466712_184151 | 3300042614 | Bacteria | 5116 |
| 86 | Ga0466718_074363 | 3300042617 | Bacteria | 12808 |
| 87 | Ga0466726_033479 | 3300042619 | Bacteria | 3112 |
| 88 | Ga0466726_430525 | 3300042619 | Bacteria | 6079 |
| 89 | Ga0466726_485611 | 3300042619 | Bacteria | 3713 |
| 90 | Ga0466729_087631 | 3300042621 | Bacteria | 1211 |
| 91 | JGI24698J34947_10022761 | 3300002449 | Bacteria | 3356 |
| 92 | JGI24698J34947_10027437 | 3300002449 | Bacteria | 3022 |
| 93 | Ga0072941_1034905 | 3300005201 | Bacteria | 5951 |
| 94 | Ga0466703_120600 | 3300042636 | Bacteria | 41888 |
| 95 | Ga0466709_029749 | 3300042648 | Bacteria | 1165 |
| 96 | Ga0264413_106796 | 3300024493 | Bacteria | 14843 |
| 97 | Ga0264413_109607 | 3300024493 | Bacteria | 10809 |
| 98 | Ga0264413_116701 | 3300024493 | Bacteria | 4731 |
| 99 | Ga0466690_086499 | 3300042590 | Bacteria | 4595 |
| 100 | Ga0466694_080334 | 3300042594 | Bacteria | 5067 |
| 101 | Ga0466699_006506 | 3300042597 | Bacteria | 1202 |
| 102 | Ga0466716_139151 | 3300042605 | Bacteria | 5305 |
| 103 | Ga0466720_040357 | 3300042607 | Bacteria | 25359 |
| 104 | Ga0466720_207766 | 3300042607 | Bacteria | 1065 |
| 105 | Ga0466712_224738 | 3300042614 | Bacteria | 3722 |
| 106 | Ga0466715_390126 | 3300042616 | Bacteria | 3164 |
| 107 | Ga0466723_180236 | 3300042618 | Bacteria | 45509 |
| 108 | Ga0466726_270658 | 3300042619 | Bacteria | 1198 |
| 109 | JGI24698J34947_10000854 | 3300002449 | Bacteria | 15334 |
| 110 | JGI24698J34947_10014590 | 3300002449 | Bacteria | 4279 |
| 111 | JGI24695J34938_10107904 | 3300002450 | Bacteria | 1135 |
| 112 | JGI24699J35502_11131587 | 3300002509 | Bacteria | 5835 |
| 113 | Ga0072941_1001886 | 3300005201 | Bacteria | 139305 |
| 114 | Ga0466704_445716 | 3300042643 | Bacteria | 38256 |
| 115 | Ga0466704_483259 | 3300042643 | Bacteria | 4257 |
| 116 | Ga0466727_112839 | 3300042655 | Bacteria | 1227 |
| 117 | Ga0466694_328093 | 3300042594 | Bacteria | 1271 |
| 118 | Ga0466699_127162 | 3300042597 | Bacteria | 1297 |
| 119 | Ga0466699_368546 | 3300042597 | Bacteria | 23219 |
| 120 | Ga0466720_130442 | 3300042607 | Bacteria | 11175 |
| 121 | Ga0466720_198506 | 3300042607 | Bacteria | 1043 |
| 122 | Ga0466722_136591 | 3300042609 | Bacteria | 3296 |
| 123 | Ga0466712_002119 | 3300042614 | Bacteria | 5352 |
| 124 | Ga0466712_023019 | 3300042614 | Bacteria | 12855 |
| 125 | Ga0466718_012681 | 3300042617 | Bacteria | 63390 |
| 126 | Ga0466723_002650 | 3300042618 | Bacteria | 6865 |
| 127 | Ga0466726_234291 | 3300042619 | Bacteria | 1622 |
| 128 | 2230941925 | 2228664002 | Bacteria | 10305 |
| 129 | JGI24698J34947_10000950 | 3300002449 | Bacteria | 14745 |
| 130 | JGI24698J34947_10002690 | 3300002449 | Bacteria | 9596 |
| 131 | JGI24698J34947_10004430 | 3300002449 | Bacteria | 7644 |
| 132 | Ga0466703_365426 | 3300042636 | Bacteria | 12555 |
| 133 | Ga0264413_110770 | 3300024493 | Bacteria | 12322 |
| 134 | Ga0466690_152260 | 3300042590 | Bacteria | 1055 |
| 135 | Ga0466691_043505 | 3300042593 | Bacteria | 8840 |
| 136 | Ga0466696_070385 | 3300042596 | Bacteria | 6644 |
| 137 | Ga0466699_012984 | 3300042597 | Bacteria | 13934 |
| 138 | Ga0466699_022579 | 3300042597 | Bacteria | 7803 |
| 139 | Ga0466699_154533 | 3300042597 | Bacteria | 1279 |
| 140 | Ga0466699_237049 | 3300042597 | Bacteria | 12893 |
| 141 | Ga0466699_325739 | 3300042597 | Bacteria | 6193 |
| 142 | Ga0466700_167652 | 3300042600 | Bacteria | 2471 |
| 143 | Ga0466713_133695 | 3300042602 | Bacteria | 1868 |
| 144 | Ga0466719_338684 | 3300042606 | Bacteria | 1781 |
| 145 | Ga0466720_063818 | 3300042607 | Bacteria | 3641 |
| 146 | Ga0466720_109763 | 3300042607 | Bacteria | 16893 |
| 147 | Ga0466722_122699 | 3300042609 | Bacteria | 6430 |
| 148 | Ga0466698_485537 | 3300042610 | Bacteria | 4310 |
| 149 | Ga0466705_091246 | 3300042612 | Bacteria | 2083 |
| 150 | Ga0466732_119822 | 3300042656 | Bacteria | 1657 |
| 151 | Ga0466732_282592 | 3300042656 | Bacteria | 22717 |
| 152 | Ga0466712_050770 | 3300042614 | Bacteria | 36007 |
| 153 | Ga0466712_120522 | 3300042614 | Bacteria | 21561 |
| 154 | Ga0466712_165381 | 3300042614 | Bacteria | 3127 |
| 155 | Ga0466711_139938 | 3300042615 | Bacteria | 4593 |
| 156 | Ga0466718_049211 | 3300042617 | Bacteria | 7929 |
| 157 | JGI24698J34947_10074555 | 3300002449 | Bacteria | 1616 |
| 158 | JGI24695J34938_10006114 | 3300002450 | Bacteria | 7326 |
| 159 | Ga0072941_1007691 | 3300005201 | Bacteria | 7673 |
| 160 | Ga0072941_1033704 | 3300005201 | Bacteria | 2591 |
| 161 | Ga0466704_323776 | 3300042643 | Bacteria | 3961 |
| 162 | Ga0264413_108494 | 3300024493 | Bacteria | 26731 |
| 163 | Ga0264413_136161 | 3300024493 | Unclassified | 1400 |
| 164 | Ga0264413_136162 | 3300024493 | Bacteria | 1344 |
| 165 | Ga0264413_139894 | 3300024493 | Bacteria | 1845 |
| 166 | Ga0466691_082520 | 3300042593 | Bacteria | 10291 |
| 167 | Ga0466691_172663 | 3300042593 | Bacteria | 2073 |
| 168 | Ga0466694_031614 | 3300042594 | Bacteria | 2687 |
| 169 | Ga0466694_156694 | 3300042594 | Bacteria | 1553 |
| 170 | Ga0466694_189956 | 3300042594 | Bacteria | 1128 |
| 171 | Ga0466699_003650 | 3300042597 | Bacteria | 2493 |
| 172 | Ga0466699_220203 | 3300042597 | Bacteria | 2636 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01875 | Memo | Memo-like protein | 67 | 321 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.