Protein Family IF05285
Metagenome
Isolate
197
Members
55
Samples
183
Scaffolds
298.09
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_069396|Ga0466699_069396_297_1337
- Length
- 346 aa
- Sequence
- MPYYSKKSPLAVSFARAAIDFLLKSIYYNNGTMYSKRTRSGYRNYIRLKRLIFSTAVLLIAGAIIAALIQYAGRFKASVGGDRKELLQFWESGSFDEVYSQSQVALVSRPMDYFLLTLRGFSAYQLGISQINKLNAAQYFEDCIRSLRKAMLLKNSVTDGRLYYVLGKAYCYKGESFADLSVRYLEKARGLSYRAADIPEYLGMAYASIGDYRNSVVAFAEALDPDQGMGISSPLLLSIARSYIALGDYGQAHAYLQRCVDISPDSRAVFSARLLLSEVLRLSGDNNGARQQLMDILEEEDNNAEAHYQLGELHALQGDLVRARAEWRLALRADPAHQKARTRLSI
Sample Types
Isolate
7.1%
Metagenome
92.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.0%
Unclassified
30.2%
Kalotermitidae
26.4%
Termopsidae
5.7%
Rhinotermitidae
3.8%
Taxonomy
Archaea
0
Bacteria
190
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 13 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 14 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 15 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 24 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 25 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 31 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 32 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 36 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 44 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 52 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_283494 | 3300042656 | Bacteria | 1697 |
| 2 | Ga0466699_069396 | 3300042597 | Bacteria | 8359 |
| 3 | Ga0466699_138050 | 3300042597 | Bacteria | 1308 |
| 4 | Ga0466718_059854 | 3300042617 | Bacteria | 2216 |
| 5 | Ga0466726_016626 | 3300042619 | Bacteria | 2133 |
| 6 | Ga0466728_428143 | 3300042620 | Bacteria | 1104 |
| 7 | JGI24698J34947_10064126 | 3300002449 | Bacteria | 1798 |
| 8 | JGI24698J34947_10079869 | 3300002449 | Bacteria | 1538 |
| 9 | JGI24698J34947_10098947 | 3300002449 | Bacteria | 1317 |
| 10 | JGI24695J34938_10019309 | 3300002450 | Bacteria | 3382 |
| 11 | Ga0466708_091958 | 3300042652 | Bacteria | 1666 |
| 12 | Ga0466720_067790 | 3300042607 | Bacteria | 8095 |
| 13 | Ga0466722_123579 | 3300042609 | Bacteria | 3581 |
| 14 | Ga0466722_174776 | 3300042609 | Bacteria | 3994 |
| 15 | Ga0466732_031478 | 3300042656 | Bacteria | 11083 |
| 16 | Ga0466690_166275 | 3300042590 | Bacteria | 4195 |
| 17 | Ga0466690_188544 | 3300042590 | Bacteria | 16088 |
| 18 | Ga0466694_053350 | 3300042594 | Bacteria | 1274 |
| 19 | Ga0466694_183897 | 3300042594 | Bacteria | 50196 |
| 20 | Ga0466699_073197 | 3300042597 | Bacteria | 1852 |
| 21 | Ga0466718_147821 | 3300042617 | Bacteria | 51565 |
| 22 | Ga0466723_065484 | 3300042618 | Bacteria | 15163 |
| 23 | Ga0123355_10018887 | 3300009826 | Bacteria | 10961 |
| 24 | Ga0123356_10000370 | 3300010049 | Bacteria | 51249 |
| 25 | Ga0123353_10464921 | 3300010167 | Bacteria | 1857 |
| 26 | Ga0123353_10516324 | 3300010167 | Bacteria | 1735 |
| 27 | JGI24698J34947_10055102 | 3300002449 | Bacteria | 1982 |
| 28 | JGI24698J34947_10095682 | 3300002449 | Unclassified | 1349 |
| 29 | Ga0466708_453446 | 3300042652 | Bacteria | 18236 |
| 30 | Ga0466707_150618 | 3300042601 | Bacteria | 1291 |
| 31 | Ga0466720_102209 | 3300042607 | Bacteria | 1288 |
| 32 | Ga0466720_230457 | 3300042607 | Bacteria | 8015 |
| 33 | Ga0466722_091590 | 3300042609 | Bacteria | 2128 |
| 34 | Ga0466722_146717 | 3300042609 | Bacteria | 2161 |
| 35 | Ga0466694_164669 | 3300042594 | Bacteria | 43666 |
| 36 | Ga0466696_157913 | 3300042596 | Bacteria | 1163 |
| 37 | Ga0466699_158565 | 3300042597 | Bacteria | 8135 |
| 38 | Ga0466699_164499 | 3300042597 | Bacteria | 2075 |
| 39 | Ga0466699_222403 | 3300042597 | Bacteria | 2005 |
| 40 | Ga0466699_293245 | 3300042597 | Bacteria | 2760 |
| 41 | Ga0466712_138199 | 3300042614 | Bacteria | 1995 |
| 42 | Ga0466726_386809 | 3300042619 | Bacteria | 35102 |
| 43 | Ga0466728_022704 | 3300042620 | Bacteria | 19629 |
| 44 | Ga0123356_10000286 | 3300010049 | Bacteria | 58205 |
| 45 | Ga0123353_10256210 | 3300010167 | Bacteria | 2706 |
| 46 | AustNasuHG_c1006386 | 3300000089 | Bacteria | 4210 |
| 47 | JGI24698J34947_10010414 | 3300002449 | Bacteria | 5099 |
| 48 | JGI24698J34947_10040843 | 3300002449 | Bacteria | 2393 |
| 49 | Ga0072941_1005529 | 3300005201 | Bacteria | 5348 |
| 50 | Ga0466727_068293 | 3300042655 | Bacteria | 9073 |
| 51 | Ga0466713_010264 | 3300042602 | Bacteria | 14885 |
| 52 | Ga0466716_456781 | 3300042605 | Bacteria | 18678 |
| 53 | Ga0466720_008600 | 3300042607 | Bacteria | 7341 |
| 54 | Ga0466720_047903 | 3300042607 | Bacteria | 1012 |
| 55 | Ga0466722_040145 | 3300042609 | Bacteria | 10406 |
| 56 | Ga0466698_290579 | 3300042610 | Bacteria | 1783 |
| 57 | Ga0466732_135013 | 3300042656 | Bacteria | 23017 |
| 58 | Ga0466690_278794 | 3300042590 | Bacteria | 28190 |
| 59 | Ga0466693_058345 | 3300042592 | Bacteria | 2946 |
| 60 | Ga0466696_407959 | 3300042596 | Bacteria | 1005 |
| 61 | Ga0466699_025262 | 3300042597 | Bacteria | 91867 |
| 62 | Ga0466699_063871 | 3300042597 | Bacteria | 6998 |
| 63 | Ga0466712_013486 | 3300042614 | Bacteria | 5276 |
| 64 | Ga0466712_053758 | 3300042614 | Bacteria | 5764 |
| 65 | Ga0466712_093396 | 3300042614 | Bacteria | 9144 |
| 66 | Ga0466718_015268 | 3300042617 | Bacteria | 2322 |
| 67 | Ga0466718_031063 | 3300042617 | Bacteria | 4380 |
| 68 | Ga0466718_116566 | 3300042617 | Bacteria | 4136 |
| 69 | Ga0123353_10012545 | 3300010167 | Bacteria | 12059 |
| 70 | Ga0123353_10027327 | 3300010167 | Bacteria | 8743 |
| 71 | JGI24698J34947_10009348 | 3300002449 | Unclassified | 5381 |
| 72 | JGI24698J34947_10032103 | 3300002449 | Bacteria | 2758 |
| 73 | JGI24698J34947_10035895 | 3300002449 | Bacteria | 2584 |
| 74 | JGI24698J34947_10045213 | 3300002449 | Bacteria | 2249 |
| 75 | JGI24698J34947_10069670 | 3300002449 | Bacteria | 1696 |
| 76 | JGI24698J34947_10095786 | 3300002449 | Bacteria | 1348 |
| 77 | Ga0072940_1093754 | 3300005200 | Bacteria | 3475 |
| 78 | Ga0072941_1001138 | 3300005201 | Bacteria | 1649 |
| 79 | Ga0466704_082459 | 3300042643 | Bacteria | 34015 |
| 80 | Ga0466709_225291 | 3300042648 | Bacteria | 1568 |
| 81 | Ga0466720_037927 | 3300042607 | Bacteria | 13057 |
| 82 | Ga0466720_092177 | 3300042607 | Bacteria | 42147 |
| 83 | Ga0466732_081577 | 3300042656 | Bacteria | 3506 |
| 84 | Ga0466691_163524 | 3300042593 | Bacteria | 21549 |
| 85 | Ga0466694_016790 | 3300042594 | Bacteria | 8380 |
| 86 | Ga0466699_080858 | 3300042597 | Bacteria | 2155 |
| 87 | Ga0466699_103429 | 3300042597 | Bacteria | 2556 |
| 88 | Ga0466699_344783 | 3300042597 | Bacteria | 5182 |
| 89 | Ga0466712_000845 | 3300042614 | Bacteria | 6256 |
| 90 | Ga0466712_282743 | 3300042614 | Unclassified | 1896 |
| 91 | Ga0466718_024400 | 3300042617 | Bacteria | 6084 |
| 92 | Ga0466718_052201 | 3300042617 | Bacteria | 4176 |
| 93 | Ga0466723_163983 | 3300042618 | Bacteria | 17494 |
| 94 | AustNasuHG_c1010819 | 3300000089 | Bacteria | 3171 |
| 95 | JGI24698J34947_10000469 | 3300002449 | Bacteria | 18845 |
| 96 | JGI24698J34947_10004226 | 3300002449 | Bacteria | 7808 |
| 97 | JGI24695J34938_10000093 | 3300002450 | Bacteria | 78486 |
| 98 | JGI24695J34938_10002760 | 3300002450 | Bacteria | 12899 |
| 99 | JGI24702J35022_10134422 | 3300002462 | Bacteria | 1375 |
| 100 | Ga0072941_1011717 | 3300005201 | Bacteria | 27881 |
| 101 | Ga0466703_419933 | 3300042636 | Bacteria | 3894 |
| 102 | Ga0466720_136084 | 3300042607 | Bacteria | 2641 |
| 103 | Ga0466722_081847 | 3300042609 | Bacteria | 9343 |
| 104 | Ga0466698_152407 | 3300042610 | Bacteria | 1991 |
| 105 | Ga0466732_113403 | 3300042656 | Bacteria | 45301 |
| 106 | Ga0466732_306330 | 3300042656 | Bacteria | 1995 |
| 107 | Ga0264413_116865 | 3300024493 | Unclassified | 10570 |
| 108 | Ga0264413_141040 | 3300024493 | Bacteria | 2351 |
| 109 | Ga0466690_315031 | 3300042590 | Bacteria | 10661 |
| 110 | Ga0466692_157140 | 3300042591 | Bacteria | 1221 |
| 111 | Ga0466696_238110 | 3300042596 | Bacteria | 2958 |
| 112 | Ga0466699_297845 | 3300042597 | Bacteria | 1403 |
| 113 | Ga0466699_434095 | 3300042597 | Bacteria | 2160 |
| 114 | Ga0466705_436623 | 3300042612 | Bacteria | 1325 |
| 115 | Ga0466712_055848 | 3300042614 | Bacteria | 20246 |
| 116 | Ga0466711_109448 | 3300042615 | Bacteria | 17747 |
| 117 | Ga0466715_032438 | 3300042616 | Bacteria | 7149 |
| 118 | Ga0466718_043017 | 3300042617 | Bacteria | 6818 |
| 119 | Ga0466718_076035 | 3300042617 | Bacteria | 62220 |
| 120 | Ga0466718_081236 | 3300042617 | Bacteria | 1636 |
| 121 | Ga0466718_098964 | 3300042617 | Bacteria | 5338 |
| 122 | Ga0123356_10059975 | 3300010049 | Bacteria | 3550 |
| 123 | Ga0123356_10424731 | 3300010049 | Bacteria | 1472 |
| 124 | JGI24695J34938_10000015 | 3300002450 | Bacteria | 118711 |
| 125 | JGI24695J34938_10000280 | 3300002450 | Bacteria | 50115 |
| 126 | JGI24695J34938_10048209 | 3300002450 | Bacteria | 1877 |
| 127 | Ga0072941_1027988 | 3300005201 | Bacteria | 5086 |
| 128 | Ga0072941_1034563 | 3300005201 | Bacteria | 2838 |
| 129 | Ga0466735_088918 | 3300042624 | Bacteria | 14989 |
| 130 | Ga0466702_033837 | 3300042635 | Bacteria | 1249 |
| 131 | Ga0466709_361210 | 3300042648 | Bacteria | 11987 |
| 132 | Ga0466720_188953 | 3300042607 | Bacteria | 1760 |
| 133 | Ga0466705_112089 | 3300042612 | Bacteria | 10305 |
| 134 | Ga0466732_237527 | 3300042656 | Bacteria | 4797 |
| 135 | Ga0466732_347137 | 3300042656 | Bacteria | 3499 |
| 136 | Ga0466692_054846 | 3300042591 | Bacteria | 1541 |
| 137 | Ga0466694_227142 | 3300042594 | Bacteria | 16205 |
| 138 | Ga0466699_429109 | 3300042597 | Bacteria | 2304 |
| 139 | Ga0466715_569105 | 3300042616 | Bacteria | 7031 |
| 140 | Ga0466718_128363 | 3300042617 | Bacteria | 9606 |
| 141 | Ga0466726_022632 | 3300042619 | Bacteria | 3964 |
| 142 | Ga0123355_10526329 | 3300009826 | Bacteria | 1443 |
| 143 | Ga0123356_10017566 | 3300010049 | Unclassified | 6805 |
| 144 | JGI24698J34947_10065721 | 3300002449 | Bacteria | 1767 |
| 145 | JGI24695J34938_10000571 | 3300002450 | Bacteria | 35414 |
| 146 | JGI24695J34938_10000948 | 3300002450 | Bacteria | 26445 |
| 147 | JGI24695J34938_10008351 | 3300002450 | Bacteria | 5918 |
| 148 | JGI24695J34938_10010210 | 3300002450 | Bacteria | 5166 |
| 149 | JGI24695J34938_10016941 | 3300002450 | Bacteria | 3690 |
| 150 | JGI24695J34938_10033498 | 3300002450 | Bacteria | 2363 |
| 151 | JGI24695J34938_10045764 | 3300002450 | Bacteria | 1939 |
| 152 | JGI24695J34938_10056240 | 3300002450 | Bacteria | 1697 |
| 153 | Ga0072941_1027989 | 3300005201 | Bacteria | 1894 |
| 154 | Ga0072941_1048378 | 3300005201 | Bacteria | 1696 |
| 155 | Ga0466703_018265 | 3300042636 | Bacteria | 18404 |
| 156 | Ga0466707_351583 | 3300042601 | Bacteria | 2212 |
| 157 | Ga0466719_070932 | 3300042606 | Unclassified | 4972 |
| 158 | Ga0466720_004095 | 3300042607 | Bacteria | 1985 |
| 159 | Ga0466720_033107 | 3300042607 | Bacteria | 10486 |
| 160 | Ga0466732_187449 | 3300042656 | Bacteria | 1537 |
| 161 | Ga0264413_105860 | 3300024493 | Bacteria | 17083 |
| 162 | Ga0466692_115561 | 3300042591 | Bacteria | 13861 |
| 163 | Ga0466693_146881 | 3300042592 | Bacteria | 11291 |
| 164 | Ga0466699_042425 | 3300042597 | Bacteria | 1261 |
| 165 | Ga0466715_206741 | 3300042616 | Bacteria | 1610 |
| 166 | Ga0466715_609198 | 3300042616 | Bacteria | 1643 |
| 167 | Ga0123356_10099508 | 3300010049 | Bacteria | 2787 |
| 168 | Ga0123354_10340142 | 3300010882 | Bacteria | 1354 |
| 169 | AustNasuHG_c1029832 | 3300000089 | Bacteria | 1586 |
| 170 | JGI24698J34947_10004525 | 3300002449 | Bacteria | 7570 |
| 171 | JGI24698J34947_10017055 | 3300002449 | Bacteria | 3939 |
| 172 | JGI24695J34938_10000322 | 3300002450 | Bacteria | 47194 |
| 173 | JGI24702J35022_10001743 | 3300002462 | Unclassified | 13485 |
| 174 | Ga0072941_1023825 | 3300005201 | Bacteria | 19578 |
| 175 | Ga0072941_1131357 | 3300005201 | Bacteria | 1269 |
| 176 | Ga0466735_100373 | 3300042624 | Bacteria | 6247 |
| 177 | Ga0466704_172194 | 3300042643 | Bacteria | 9834 |
| 178 | Ga0466727_019988 | 3300042655 | Bacteria | 2659 |
| 179 | Ga0466720_028618 | 3300042607 | Bacteria | 12415 |
| 180 | Ga0466720_032156 | 3300042607 | Bacteria | 10784 |
| 181 | Ga0466720_041020 | 3300042607 | Bacteria | 1271 |
| 182 | Ga0466720_236373 | 3300042607 | Bacteria | 1398 |
| 183 | Ga0466722_266862 | 3300042609 | Bacteria | 10489 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.