Protein Family IF05280
Metagenome
Isolate
152
Members
48
Samples
143
Scaffolds
419.59
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_054907|Ga0466699_054907_11208_12668
- Length
- 486 aa
- Sequence
- VFTALTGIWSDFAPSVAQISVLLTFWWPVCLIVPNIVPMCTSWAAANAGARGYKPRLYAFFTFLGHTVTMEIQKITDQQLESLLVPRFMNYVRYWTESDRHVEATPSSLGQWDLARALQGELLGLGVTDVELTPHCYVIARLPASTGRENAPVVGFLAHLDTANDVSGKDVSPQLVRNYDGETIALSGGLTLNPAKESGLAEQKGKAIIHSSGDTLLGADDKAGIAEIMAAVEYLAAHPEIPHGPVEVLFSPDEETGKGLPEFPLEKIKSAVCYTLDGGPIGEIEAECFNAWKADIECTGKVIHLGTARGVLANAALMAASYAVMLPRSESPEATDGYYGYYCPMELSGGLESARLEIFVRDFESNGIKRRLEALEAIAKAVEAQFPNGRVIVKTSPQYYNMREKIGEKPQALERLKAALDNTGIGWRLKPIRGGTDGSRLTEMGIPTPNIFTGGRNFHSRLEWVAVSEMCAASRLVIELIRLWGE
Sample Types
Isolate
5.9%
Metagenome
94.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.5%
Kalotermitidae
26.1%
Unclassified
19.6%
Rhinotermitidae
6.5%
Termopsidae
4.3%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
1
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 2 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 11 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 35 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 39 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 40 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 41 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 42 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_085342 | 3300042612 | Bacteria | 11173 |
| 2 | Ga0466712_014889 | 3300042614 | Bacteria | 58641 |
| 3 | Ga0466712_079080 | 3300042614 | Unclassified | 3078 |
| 4 | Ga0466712_106176 | 3300042614 | Bacteria | 11255 |
| 5 | Ga0466712_172842 | 3300042614 | Bacteria | 4312 |
| 6 | Ga0466712_208852 | 3300042614 | Bacteria | 6962 |
| 7 | Ga0466726_018267 | 3300042619 | Bacteria | 2285 |
| 8 | JGI24698J34947_10038380 | 3300002449 | Bacteria | 2484 |
| 9 | Ga0072941_1078936 | 3300005201 | Bacteria | 2142 |
| 10 | Ga0466717_184442 | 3300042604 | Bacteria | 2307 |
| 11 | Ga0466720_049135 | 3300042607 | Bacteria | 3427 |
| 12 | Ga0466720_121414 | 3300042607 | Bacteria | 2952 |
| 13 | Ga0466720_155926 | 3300042607 | Bacteria | 8087 |
| 14 | Ga0466722_076177 | 3300042609 | Bacteria | 29982 |
| 15 | Ga0415639_019683 | 3300038395 | Bacteria | 4950 |
| 16 | Ga0466692_204781 | 3300042591 | Bacteria | 2577 |
| 17 | Ga0466696_363235 | 3300042596 | Bacteria | 9044 |
| 18 | Ga0466699_083059 | 3300042597 | Bacteria | 1657 |
| 19 | Ga0466732_152032 | 3300042656 | Bacteria | 16830 |
| 20 | Ga0466712_190509 | 3300042614 | Bacteria | 3345 |
| 21 | Ga0466712_197672 | 3300042614 | Bacteria | 27405 |
| 22 | Ga0466715_318281 | 3300042616 | Bacteria | 7650 |
| 23 | Ga0466723_015264 | 3300042618 | Bacteria | 20872 |
| 24 | Ga0123356_10000063 | 3300010049 | Bacteria | 111723 |
| 25 | Ga0123356_10111150 | 3300010049 | Bacteria | 2647 |
| 26 | Ga0466702_005888 | 3300042635 | Bacteria | 1983 |
| 27 | Ga0466704_334572 | 3300042643 | Bacteria | 24393 |
| 28 | Ga0466708_290132 | 3300042652 | Bacteria | 5315 |
| 29 | AustNasuHG_c1000778 | 3300000089 | Bacteria | 11371 |
| 30 | AustNasuHG_c1001656 | 3300000089 | Bacteria | 8030 |
| 31 | JGI24698J34947_10010364 | 3300002449 | Viruses | 5111 |
| 32 | JGI24698J34947_10012783 | 3300002449 | Bacteria | 4594 |
| 33 | JGI24695J34938_10001058 | 3300002450 | Bacteria | 24980 |
| 34 | JGI24695J34938_10001921 | 3300002450 | Bacteria | 16770 |
| 35 | JGI24695J34938_10038393 | 3300002450 | Bacteria | 2169 |
| 36 | Ga0072940_1019089 | 3300005200 | Bacteria | 4796 |
| 37 | Ga0072941_1002626 | 3300005201 | Bacteria | 4382 |
| 38 | Ga0072941_1008375 | 3300005201 | Bacteria | 46242 |
| 39 | Ga0072941_1016189 | 3300005201 | Bacteria | 4050 |
| 40 | Ga0072941_1035223 | 3300005201 | Bacteria | 6846 |
| 41 | Ga0466720_040705 | 3300042607 | Unclassified | 3026 |
| 42 | Ga0466720_074735 | 3300042607 | Bacteria | 14166 |
| 43 | Ga0466692_092840 | 3300042591 | Bacteria | 19467 |
| 44 | Ga0466693_021526 | 3300042592 | Bacteria | 40073 |
| 45 | Ga0466699_124796 | 3300042597 | Bacteria | 11856 |
| 46 | Ga0466732_181080 | 3300042656 | Bacteria | 6138 |
| 47 | Ga0466712_187290 | 3300042614 | Unclassified | 12180 |
| 48 | Ga0466718_040373 | 3300042617 | Bacteria | 43603 |
| 49 | Ga0466729_053287 | 3300042621 | Bacteria | 2955 |
| 50 | Ga0123356_10000034 | 3300010049 | Bacteria | 149865 |
| 51 | Ga0123356_10040478 | 3300010049 | Bacteria | 4342 |
| 52 | JGI24698J34947_10005347 | 3300002449 | Bacteria | 7043 |
| 53 | JGI24695J34938_10010181 | 3300002450 | Bacteria | 5176 |
| 54 | Ga0466691_138961 | 3300042593 | Bacteria | 7941 |
| 55 | Ga0466694_146969 | 3300042594 | Bacteria | 18139 |
| 56 | Ga0466694_284619 | 3300042594 | Bacteria | 2287 |
| 57 | Ga0466699_063007 | 3300042597 | Bacteria | 4270 |
| 58 | Ga0466699_152090 | 3300042597 | Bacteria | 7786 |
| 59 | Ga0466699_250841 | 3300042597 | Bacteria | 13968 |
| 60 | Ga0466712_003489 | 3300042614 | Bacteria | 9502 |
| 61 | Ga0466715_090402 | 3300042616 | Bacteria | 11159 |
| 62 | Ga0466723_234455 | 3300042618 | Bacteria | 13642 |
| 63 | Ga0466709_210607 | 3300042648 | Bacteria | 9464 |
| 64 | Ga0466708_049646 | 3300042652 | Bacteria | 17359 |
| 65 | JGI24698J34947_10007078 | 3300002449 | Bacteria | 6163 |
| 66 | JGI24695J34938_10004103 | 3300002450 | Bacteria | 9710 |
| 67 | JGI24695J34938_10024799 | 3300002450 | Bacteria | 2876 |
| 68 | Ga0072941_1103072 | 3300005201 | Bacteria | 2857 |
| 69 | Ga0466720_108188 | 3300042607 | Bacteria | 2342 |
| 70 | Ga0466720_234494 | 3300042607 | Bacteria | 24308 |
| 71 | Ga0264413_102820 | 3300024493 | Bacteria | 21633 |
| 72 | Ga0466694_099577 | 3300042594 | Bacteria | 97987 |
| 73 | Ga0466732_225559 | 3300042656 | Bacteria | 17786 |
| 74 | Ga0466712_041345 | 3300042614 | Bacteria | 10603 |
| 75 | Ga0466712_065155 | 3300042614 | Bacteria | 3226 |
| 76 | Ga0466712_066093 | 3300042614 | Bacteria | 8090 |
| 77 | Ga0466715_273780 | 3300042616 | Bacteria | 15926 |
| 78 | Ga0123356_10000120 | 3300010049 | Bacteria | 85763 |
| 79 | Ga0123356_10002470 | 3300010049 | Bacteria | 19739 |
| 80 | Ga0123356_10003845 | 3300010049 | Bacteria | 15640 |
| 81 | Ga0123356_10130383 | 3300010049 | Bacteria | 2462 |
| 82 | Ga0123353_10074694 | 3300010167 | Bacteria | 5449 |
| 83 | Ga0466703_094648 | 3300042636 | Bacteria | 7107 |
| 84 | Ga0072941_1000285 | 3300005201 | Bacteria | 12800 |
| 85 | Ga0466720_156791 | 3300042607 | Bacteria | 1762 |
| 86 | Ga0264413_104765 | 3300024493 | Bacteria | 3250 |
| 87 | Ga0466690_122739 | 3300042590 | Bacteria | 16947 |
| 88 | Ga0466694_161993 | 3300042594 | Bacteria | 2698 |
| 89 | Ga0466699_054907 | 3300042597 | Bacteria | 12987 |
| 90 | Ga0466705_210081 | 3300042612 | Bacteria | 20349 |
| 91 | Ga0466718_022534 | 3300042617 | Bacteria | 17892 |
| 92 | Ga0123355_10222430 | 3300009826 | Bacteria | 2712 |
| 93 | JGI24698J34947_10059372 | 3300002449 | Bacteria | 1891 |
| 94 | JGI24695J34938_10000835 | 3300002450 | Bacteria | 28598 |
| 95 | JGI24695J34938_10004774 | 3300002450 | Bacteria | 8733 |
| 96 | JGI24695J34938_10010982 | 3300002450 | Bacteria | 4918 |
| 97 | JGI24695J34938_10025621 | 3300002450 | Bacteria | 2816 |
| 98 | Ga0466720_022178 | 3300042607 | Bacteria | 17065 |
| 99 | Ga0466720_227520 | 3300042607 | Bacteria | 2370 |
| 100 | Ga0466722_053513 | 3300042609 | Bacteria | 19310 |
| 101 | Ga0466722_111455 | 3300042609 | Bacteria | 7413 |
| 102 | Ga0264413_100183 | 3300024493 | Bacteria | 10534 |
| 103 | Ga0264413_102035 | 3300024493 | Bacteria | 16598 |
| 104 | Ga0415639_040258 | 3300038395 | Bacteria | 2801 |
| 105 | Ga0466699_171843 | 3300042597 | Bacteria | 6511 |
| 106 | Ga0466732_207623 | 3300042656 | Bacteria | 13905 |
| 107 | Ga0466712_007226 | 3300042614 | Bacteria | 3769 |
| 108 | Ga0466712_049149 | 3300042614 | Bacteria | 2764 |
| 109 | Ga0466711_399810 | 3300042615 | Bacteria | 4367 |
| 110 | Ga0466715_501244 | 3300042616 | Bacteria | 18463 |
| 111 | Ga0466718_072200 | 3300042617 | Bacteria | 3295 |
| 112 | Ga0466718_144021 | 3300042617 | Bacteria | 5974 |
| 113 | Ga0466723_008859 | 3300042618 | Bacteria | 3099 |
| 114 | Ga0123353_10452082 | 3300010167 | Bacteria | 1891 |
| 115 | Ga0466708_038315 | 3300042652 | Bacteria | 5243 |
| 116 | Ga0466727_247045 | 3300042655 | Bacteria | 3776 |
| 117 | 2230929947 | 2228664001 | Bacteria | 8707 |
| 118 | JGI24698J34947_10000326 | 3300002449 | Bacteria | 21051 |
| 119 | JGI24698J34947_10014726 | 3300002449 | Bacteria | 4261 |
| 120 | JGI24695J34938_10001974 | 3300002450 | Bacteria | 16383 |
| 121 | JGI24695J34938_10021724 | 3300002450 | Bacteria | 3133 |
| 122 | JGI24702J35022_10008267 | 3300002462 | Bacteria | 5899 |
| 123 | Ga0466720_019008 | 3300042607 | Bacteria | 18978 |
| 124 | Ga0264413_103394 | 3300024493 | Bacteria | 29703 |
| 125 | Ga0264413_104061 | 3300024493 | Bacteria | 24138 |
| 126 | Ga0466712_096713 | 3300042614 | Bacteria | 9797 |
| 127 | Ga0466712_320398 | 3300042614 | Unclassified | 1719 |
| 128 | Ga0466711_242122 | 3300042615 | Bacteria | 1847 |
| 129 | Ga0466718_001814 | 3300042617 | Bacteria | 3372 |
| 130 | Ga0466718_074547 | 3300042617 | Bacteria | 15424 |
| 131 | Ga0466728_115103 | 3300042620 | Bacteria | 5613 |
| 132 | Ga0466704_561110 | 3300042643 | Bacteria | 7849 |
| 133 | JGI24698J34947_10004392 | 3300002449 | Bacteria | 7673 |
| 134 | JGI24695J34938_10000339 | 3300002450 | Bacteria | 46161 |
| 135 | JGI24695J34938_10000638 | 3300002450 | Bacteria | 33425 |
| 136 | Ga0466720_001832 | 3300042607 | Bacteria | 3169 |
| 137 | Ga0466720_019755 | 3300042607 | Bacteria | 3743 |
| 138 | Ga0466720_233106 | 3300042607 | Bacteria | 42880 |
| 139 | Ga0466722_005215 | 3300042609 | Bacteria | 9985 |
| 140 | Ga0466698_294627 | 3300042610 | Bacteria | 1608 |
| 141 | Ga0466694_094780 | 3300042594 | Bacteria | 2018 |
| 142 | Ga0466699_068459 | 3300042597 | Bacteria | 23612 |
| 143 | Ga0466699_250291 | 3300042597 | Bacteria | 49857 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01546 | Peptidase_M20 | Peptidase family M20/M25/M40 | 219 | 481 | 0.83 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01546 | GO:0016787 | hydrolase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.