Protein Family IF05259

Metagenome Isolate
114 Members
47 Samples
102 Scaffolds
169.78 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_503979|Ga0466696_503979_103_645
Length
180 aa
Sequence
LFIVTIRRRNMCDNCGANAVYSDADFKELAPVLDKYGGVKGSLITILQKAQDVYGYLSLDTINYISAKIGVAPAKIYGVATFYTQFRLEPIGEYLIMLCHGTACHVNGAVKIEEAISEHLGIADGETTEDNKFTLNNVACLGCCSLAPVMMVKGPDGDETFGNLTKESAVKALEQIRARG

📊 Sample Types

Isolate 10.5%
Metagenome 89.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.4%
Unclassified 24.4%
Kalotermitidae 15.6%
Termopsidae 6.7%
Rhinotermitidae 4.4%
Stratiomyidae 2.2%
Blattidae 2.2%

🌳 Taxonomy

Archaea 1
Bacteria 103
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
2 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
3 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
4 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
7 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
16 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
22 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
25 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
26 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
31 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
32 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
35 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
36 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
37 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
40 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
42 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
43 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
44 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
45 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_113280 3300038395 Bacteria 1189
2 Ga0466726_305866 3300042619 Bacteria 3414
3 Ga0123353_10237405 3300010167 Bacteria 2836
4 Ga0123353_10504790 3300010167 Bacteria 1761
5 Ga0123353_11046733 3300010167 Bacteria 1091
6 Ga0123353_11136471 3300010167 Unclassified 1033
7 Ga0123353_11819499 3300010167 Bacteria 756
8 Ga0123354_10323796 3300010882 Bacteria 1418
9 Ga0466719_524036 3300042606 Unclassified 1568
10 JGI24702J35022_10015775 3300002462 Bacteria 4150
11 JGI24702J35022_10233525 3300002462 Bacteria 1064
12 Ga0466705_255392 3300042612 Bacteria 1695
13 Ga0466699_246917 3300042597 Bacteria 2257
14 Ga0466734_090539 3300042623 Bacteria 1181
15 Ga0466703_385945 3300042636 Bacteria 1068
16 Ga0466704_428659 3300042643 Bacteria 11210
17 Ga0123356_10022988 3300010049 Bacteria 5877
18 Ga0123356_10178257 3300010049 Bacteria 2144
19 Ga0123356_10223591 3300010049 Bacteria 1941
20 Ga0123353_11476354 3300010167 Bacteria 868
21 Ga0123353_11875041 3300010167 Bacteria 741
22 Ga0466707_207076 3300042601 Bacteria 36585
23 Ga0466719_301539 3300042606 Bacteria 2509
24 Ga0466722_205398 3300042609 Bacteria 6921
25 Ga0466705_234819 3300042612 Unclassified 2800
26 Ga0123357_10367027 3300009784 Bacteria 1355
27 Ga0123355_10161212 3300009826 Bacteria 3378
28 Ga0123356_10753513 3300010049 Bacteria 1144
29 Ga0123353_10253948 3300010167 Bacteria 2720
30 Ga0123353_10468947 3300010167 Bacteria 1847
31 Ga0123353_10532970 3300010167 Bacteria 1699
32 Ga0123353_11125079 3300010167 Bacteria 1039
33 Ga0123353_12016532 3300010167 Bacteria 706
34 Ga0466707_350013 3300042601 Bacteria 4359
35 JGI24705J35276_12174390 3300002504 Bacteria 1317
36 Ga0072941_1314723 3300005201 Unclassified 1639
37 Ga0466694_031830 3300042594 Bacteria 3978
38 Ga0466696_222883 3300042596 Bacteria 10125
39 Ga0466715_559989 3300042616 Bacteria 7858
40 Ga0123353_10012673 3300010167 Bacteria 12015
41 Ga0123353_10017764 3300010167 Bacteria 10480
42 Ga0123353_10052663 3300010167 Bacteria 6500
43 Ga0123353_10428909 3300010167 Bacteria 1956
44 Ga0123353_10489955 3300010167 Bacteria 1795
45 Ga0123353_10776063 3300010167 Unclassified 1329
46 JGI24702J35022_10000205 3300002462 Bacteria 32389
47 Ga0068302_10435336 3300005071 Bacteria 589
48 Ga0466693_341493 3300042592 Bacteria 3699
49 Ga0466696_437995 3300042596 Bacteria 6870
50 Ga0466699_038637 3300042597 Bacteria 14240
51 Ga0466711_055050 3300042615 Bacteria 13644
52 Ga0466704_149301 3300042643 Unclassified 3928
53 Ga0123353_10131654 3300010167 Unclassified 4012
54 Ga0123353_10415062 3300010167 Bacteria 1997
55 Ga0123353_10688407 3300010167 Bacteria 1438
56 Ga0123353_11878628 3300010167 Bacteria 740
57 Ga0466721_344985 3300042608 Bacteria 6539
58 JGI24702J35022_10063996 3300002462 Bacteria 1971
59 JGI24705J35276_12212055 3300002504 Bacteria 1876
60 Ga0068302_10212309 3300005071 Bacteria 1249
61 Ga0466693_273111 3300042592 Bacteria 1531
62 Ga0466696_110846 3300042596 Unclassified 3646
63 Ga0466703_151292 3300042636 Archaea 1933
64 Ga0466704_579071 3300042643 Bacteria 18573
65 Ga0466725_005696 3300042654 Bacteria 5361
66 Ga0123356_10017396 3300010049 Bacteria 6839
67 Ga0123353_10013692 3300010167 Bacteria 11631
68 Ga0123353_10064234 3300010167 Bacteria 5890
69 Ga0123353_10108491 3300010167 Bacteria 4474
70 Ga0123353_10527213 3300010167 Bacteria 1712
71 Ga0123353_10637184 3300010167 Bacteria 1513
72 Ga0123353_10916339 3300010167 Bacteria 1191
73 Ga0123354_10315915 3300010882 Bacteria 1450
74 Ga0123354_10550991 3300010882 Bacteria 869
75 Ga0466701_022933 3300042598 Bacteria 1036
76 Ga0466722_216392 3300042609 Bacteria 1631
77 Ga0466733_156735 3300042659 Bacteria 5520
78 Ga0466692_128044 3300042591 Bacteria 6165
79 Ga0466718_013585 3300042617 Bacteria 1226
80 Ga0466731_065542 3300042622 Bacteria 2694
81 Ga0466704_188582 3300042643 Bacteria 1278
82 Ga0466704_260438 3300042643 Unclassified 3536
83 Ga0123356_10023875 3300010049 Bacteria 5754
84 Ga0123356_10053964 3300010049 Bacteria 3742
85 Ga0123356_10120782 3300010049 Bacteria 2548
86 Ga0123356_13239430 3300010049 Bacteria 566
87 Ga0123353_10121058 3300010167 Bacteria 4208
88 Ga0123353_10896412 3300010167 Bacteria 1208
89 Ga0123354_10067074 3300010882 Bacteria 5230
90 Ga0466700_044666 3300042600 Bacteria 1270
91 JGI24702J35022_10000274 3300002462 Bacteria 29801
92 JGI24702J35022_10151926 3300002462 Bacteria 1299
93 Ga0264413_134926 3300024493 Bacteria 5577
94 Ga0415639_102400 3300038395 Bacteria 1804
95 Ga0466694_373222 3300042594 Bacteria 7632
96 Ga0466696_503979 3300042596 Bacteria 1159
97 Ga0466731_302498 3300042622 Bacteria 1821
98 Ga0466725_363086 3300042654 Bacteria 2685
99 Ga0466727_230284 3300042655 Bacteria 9423
100 Ga0123353_10530803 3300010167 Bacteria 1704
101 Ga0123353_10734843 3300010167 Bacteria 1377
102 Ga0466717_141278 3300042604 Unclassified 1659

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_11136471 Ga0123353_111364712 140
2 3300042622 Ga0466731_065542 Ga0466731_065542_2028_2492 154
3 3300024493 Ga0264413_134926 Ga0264413_1349262 156
4 3300042619 Ga0466726_305866 Ga0466726_305866_743_1213 156
5 3300010167 Ga0123353_10688407 Ga0123353_106884072 159
6 3300010167 Ga0123353_11875041 Ga0123353_118750412 159
7 3300005071 Ga0068302_10435336 Ga0068302_104353361 160
8 3300010049 Ga0123356_10223591 Ga0123356_102235912 161
9 3300010167 Ga0123353_10530803 Ga0123353_105308032 161
10 3300042615 Ga0466711_055050 Ga0466711_055050_6819_7304 161
11 3300010882 Ga0123354_10550991 Ga0123354_105509911 162
12 iso_pr_bacteria 2820647881 2820648291 162
13 3300010049 Ga0123356_10023875 Ga0123356_100238753 163
14 3300042592 Ga0466693_273111 Ga0466693_273111_74_565 163
15 3300042598 Ga0466701_022933 Ga0466701_022933_18_509 163
16 3300042592 Ga0466693_341493 Ga0466693_341493_2173_2667 164
17 3300042622 Ga0466731_302498 Ga0466731_302498_1093_1587 164
18 iso_pr_bacteria 2820231849 2820232415 164
19 3300002462 JGI24702J35022_10000274 JGI24702J35022_1000027425 165
20 3300042596 Ga0466696_222883 Ga0466696_222883_1777_2274 165
21 3300042654 Ga0466725_005696 Ga0466725_005696_1945_2442 165
22 iso_pr_bacteria 2820282995 2820284865 165
23 3300002462 JGI24702J35022_10063996 JGI24702J35022_100639962 166
24 3300010167 Ga0123353_10108491 Ga0123353_101084912 166
25 3300010167 Ga0123353_10415062 Ga0123353_104150623 166
26 3300010167 Ga0123353_10776063 Ga0123353_107760632 166
27 3300010167 Ga0123353_11476354 Ga0123353_114763541 167
28 3300042594 Ga0466694_031830 Ga0466694_031830_2635_3138 167
29 3300042604 Ga0466717_141278 Ga0466717_141278_530_1033 167
30 3300002462 JGI24702J35022_10233525 JGI24702J35022_102335252 168
31 3300002504 JGI24705J35276_12174390 JGI24705J35276_121743902 168
32 3300010167 Ga0123353_10237405 Ga0123353_102374052 168
33 3300010882 Ga0123354_10323796 Ga0123354_103237962 168
34 3300042591 Ga0466692_128044 Ga0466692_128044_5381_5887 168
35 3300042596 Ga0466696_110846 Ga0466696_110846_2492_2998 168
36 3300042596 Ga0466696_437995 Ga0466696_437995_3140_3646 168
37 3300042606 Ga0466719_301539 Ga0466719_301539_561_1067 168
38 3300042606 Ga0466719_524036 Ga0466719_524036_771_1277 168
39 3300042609 Ga0466722_205398 Ga0466722_205398_3934_4440 168
40 3300042612 Ga0466705_234819 Ga0466705_234819_1764_2270 168
41 3300042616 Ga0466715_559989 Ga0466715_559989_5339_5845 168
42 3300042636 Ga0466703_151292 Ga0466703_151292_158_664 168
43 3300042643 Ga0466704_149301 Ga0466704_149301_1744_2250 168
44 3300042643 Ga0466704_188582 Ga0466704_188582_335_841 168
45 3300042643 Ga0466704_260438 Ga0466704_260438_2591_3097 168
46 3300042643 Ga0466704_428659 Ga0466704_428659_9450_9956 168
47 3300002462 JGI24702J35022_10151926 JGI24702J35022_101519261 169
48 3300010167 Ga0123353_10734843 Ga0123353_107348432 169
49 3300042597 Ga0466699_246917 Ga0466699_246917_103_612 169
50 3300042601 Ga0466707_207076 Ga0466707_207076_19329_19838 169
51 3300042623 Ga0466734_090539 Ga0466734_090539_192_701 169
52 3300042654 Ga0466725_363086 Ga0466725_363086_870_1379 169
53 iso_pr_bacteria 2781125693 2781433816 169
54 iso_pr_bacteria 2940228231 2940228758 169
55 iso_pr_bacteria 8064531044 8064533638 169
56 3300005071 Ga0068302_10212309 Ga0068302_102123091 170
57 3300005201 Ga0072941_1314723 Ga0072941_13147233 170
58 3300009784 Ga0123357_10367027 Ga0123357_103670272 170
59 3300010167 Ga0123353_10012673 Ga0123353_100126737 170
60 3300042594 Ga0466694_373222 Ga0466694_373222_333_845 170
61 3300042597 Ga0466699_038637 Ga0466699_038637_7194_7706 170
62 3300042600 Ga0466700_044666 Ga0466700_044666_493_1005 170
63 3300042609 Ga0466722_216392 Ga0466722_216392_539_1051 170
64 3300042617 Ga0466718_013585 Ga0466718_013585_408_920 170
65 3300042636 Ga0466703_385945 Ga0466703_385945_20_532 170
66 3300042655 Ga0466727_230284 Ga0466727_230284_123_635 170
67 iso_pr_bacteria 2820220859 2820221641 170
68 iso_pr_bacteria 2820593525 2820594388 170
69 3300002462 JGI24702J35022_10000205 JGI24702J35022_100002059 171
70 3300002462 JGI24702J35022_10015775 JGI24702J35022_100157751 171
71 3300009826 Ga0123355_10161212 Ga0123355_101612122 171
72 3300010049 Ga0123356_10053964 Ga0123356_100539642 171
73 3300010049 Ga0123356_10120782 Ga0123356_101207823 171
74 3300010049 Ga0123356_10178257 Ga0123356_101782572 171
75 3300010167 Ga0123353_10064234 Ga0123353_100642344 171
76 3300010167 Ga0123353_10131654 Ga0123353_101316542 171
77 3300010167 Ga0123353_10468947 Ga0123353_104689472 171
78 3300010167 Ga0123353_10527213 Ga0123353_105272132 171
79 3300010167 Ga0123353_10637184 Ga0123353_106371842 171
80 3300010167 Ga0123353_10916339 Ga0123353_109163393 171
81 3300010167 Ga0123353_11046733 Ga0123353_110467332 171
82 3300010167 Ga0123353_11125079 Ga0123353_111250792 171
83 3300010882 Ga0123354_10067074 Ga0123354_100670741 171
84 3300010882 Ga0123354_10315915 Ga0123354_103159151 171
85 3300002504 JGI24705J35276_12212055 JGI24705J35276_122120552 172
86 3300010167 Ga0123353_10428909 Ga0123353_104289092 172
87 3300010167 Ga0123353_12016532 Ga0123353_120165321 172
88 3300038395 Ga0415639_113280 Ga0415639_113280_184_702 172
89 3300010167 Ga0123353_10013692 Ga0123353_100136922 173
90 3300010167 Ga0123353_10017764 Ga0123353_100177641 173
91 3300010167 Ga0123353_10052663 Ga0123353_100526633 173
92 3300042608 Ga0466721_344985 Ga0466721_344985_3600_4121 173
93 3300010049 Ga0123356_13239430 Ga0123356_132394301 174
94 3300010167 Ga0123353_10504790 Ga0123353_105047902 174
95 3300042601 Ga0466707_350013 Ga0466707_350013_3039_3563 174
96 3300010167 Ga0123353_11819499 Ga0123353_118194992 175
97 3300042612 Ga0466705_255392 Ga0466705_255392_910_1437 175
98 3300042643 Ga0466704_579071 Ga0466704_579071_5565_6092 175
99 iso_pr_bacteria 2820344559 2820346758 175
100 iso_pr_bacteria 2820357977 2820358230 176
101 iso_pr_bacteria 8030337018 8030338093 176
102 3300042659 Ga0466733_156735 Ga0466733_156735_4422_4955 177
103 3300010049 Ga0123356_10017396 Ga0123356_100173961 178
104 3300010049 Ga0123356_10753513 Ga0123356_107535132 179
105 3300010167 Ga0123353_10121058 Ga0123353_101210584 179
106 3300010167 Ga0123353_10489955 Ga0123353_104899551 179
107 3300010167 Ga0123353_10532970 Ga0123353_105329702 179
108 iso_pr_bacteria 2820234266 2820235136 179
109 3300042596 Ga0466696_503979 Ga0466696_503979_103_645 180
110 3300010167 Ga0123353_10253948 Ga0123353_102539482 183
111 3300038395 Ga0415639_102400 Ga0415639_102400_1018_1569 183
112 3300010167 Ga0123353_10896412 Ga0123353_108964123 190
113 3300010049 Ga0123356_10022988 Ga0123356_100229882 194
114 3300010167 Ga0123353_11878628 Ga0123353_118786282 201

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin 32 176 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.66 0.72 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.