Protein Family IF05256
Metagenome
Isolate
133
Members
65
Samples
114
Scaffolds
211.68
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_491702|Ga0466696_491702_86_820
- Length
- 244 aa
- Sequence
- MWLENLSWFGSLRIKTVTFSTEAFVGNVCSSGSGMSDTTAWLSSAYLAPVDYYMCLARFDEIIIEQHCNYIKQTYRNRCRIASANGLQVLSIPVERTGSAKCLTKDLRISDHGNWRHLHWNAIVSAYNSTPFFEYYEDDFRPFYERKFEFLFDFNETLRELVCRLIDIEPKISYTSSYGISGDNILNPDSCENDFRELIHPKKNSVHRTFKPYYQVFDSKFGFQSGLSIIDLLFNMGPESILFL
Sample Types
Isolate
14.3%
Metagenome
85.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.3%
Kalotermitidae
21.5%
Unclassified
13.8%
Blattidae
13.8%
Rhinotermitidae
7.7%
Termopsidae
4.6%
Hydrophilidae
3.1%
Drosophilidae
1.5%
Hodotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
1
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 2 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 5 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 6 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 7 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 8 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 9 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 23 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 44 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 45 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 46 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 47 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 48 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 49 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 53 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 54 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 55 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 56 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 57 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 58 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 59 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 60 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 61 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 62 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 63 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 64 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 65 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466722_062472 | 3300042609 | Bacteria | 2505 |
| 2 | Ga0466695_159436 | 3300042595 | Bacteria | 18608 |
| 3 | Ga0466696_176785 | 3300042596 | Bacteria | 19925 |
| 4 | Ga0466696_502505 | 3300042596 | Bacteria | 3301 |
| 5 | Ga0123356_11010620 | 3300010049 | Bacteria | 1002 |
| 6 | Ga0123354_10000565 | 3300010882 | Bacteria | 38228 |
| 7 | Ga0466729_049540 | 3300042621 | Bacteria | 2427 |
| 8 | Ga0466734_116528 | 3300042623 | Bacteria | 3470 |
| 9 | Ga0466735_009753 | 3300042624 | Bacteria | 7578 |
| 10 | Ga0466735_200979 | 3300042624 | Bacteria | 5294 |
| 11 | Ga0466727_026681 | 3300042655 | Bacteria | 4518 |
| 12 | Ga0466727_230118 | 3300042655 | Bacteria | 5057 |
| 13 | JGI24702J35022_10024510 | 3300002462 | Bacteria | 3259 |
| 14 | Ga0466733_172872 | 3300042659 | Unclassified | 6351 |
| 15 | Ga0466706_156084 | 3300042599 | Bacteria | 15343 |
| 16 | Ga0466713_130649 | 3300042602 | Bacteria | 5951 |
| 17 | Ga0466657_324794 | 3300042582 | Bacteria | 2607 |
| 18 | Ga0123354_10004445 | 3300010882 | Bacteria | 19882 |
| 19 | Ga0466715_572377 | 3300042616 | Bacteria | 2364 |
| 20 | Ga0466735_162853 | 3300042624 | Bacteria | 2658 |
| 21 | Ga0466703_209908 | 3300042636 | Bacteria | 15354 |
| 22 | Ga0466703_286565 | 3300042636 | Bacteria | 10843 |
| 23 | Ga0466703_318682 | 3300042636 | Bacteria | 11416 |
| 24 | Ga0466703_318839 | 3300042636 | Bacteria | 3814 |
| 25 | Ga0466709_040085 | 3300042648 | Bacteria | 30054 |
| 26 | Ga0466732_374762 | 3300042656 | Bacteria | 2825 |
| 27 | Ga0466733_078580 | 3300042659 | Bacteria | 13313 |
| 28 | Ga0466706_288954 | 3300042599 | Bacteria | 24469 |
| 29 | Ga0466714_017724 | 3300042603 | Bacteria | 3052 |
| 30 | Ga0466714_120135 | 3300042603 | Bacteria | 12630 |
| 31 | Ga0466692_088040 | 3300042591 | Bacteria | 4869 |
| 32 | Ga0466693_190261 | 3300042592 | Bacteria | 1598 |
| 33 | Ga0466696_086524 | 3300042596 | Bacteria | 3435 |
| 34 | Ga0123356_10240367 | 3300010049 | Bacteria | 1881 |
| 35 | Ga0466711_373454 | 3300042615 | Bacteria | 2212 |
| 36 | Ga0466723_184502 | 3300042618 | Bacteria | 6295 |
| 37 | Ga0466726_016746 | 3300042619 | Bacteria | 3745 |
| 38 | Ga0466728_249094 | 3300042620 | Bacteria | 125538 |
| 39 | Ga0466735_013961 | 3300042624 | Bacteria | 4005 |
| 40 | Ga0466704_259053 | 3300042643 | Bacteria | 5411 |
| 41 | JGI24696J40584_12920424 | 3300002834 | Bacteria | 1342 |
| 42 | Ga0466705_373818 | 3300042612 | Bacteria | 18025 |
| 43 | Ga0466733_127865 | 3300042659 | Bacteria | 19394 |
| 44 | Ga0466707_368503 | 3300042601 | Bacteria | 3522 |
| 45 | Ga0466713_059440 | 3300042602 | Bacteria | 68698 |
| 46 | Ga0466714_045701 | 3300042603 | Bacteria | 3613 |
| 47 | Ga0466722_136926 | 3300042609 | Bacteria | 3300 |
| 48 | Ga0466690_229678 | 3300042590 | Bacteria | 4764 |
| 49 | Ga0466695_027096 | 3300042595 | Bacteria | 1333 |
| 50 | Ga0466695_034169 | 3300042595 | Bacteria | 2473 |
| 51 | Ga0466696_360518 | 3300042596 | Bacteria | 27145 |
| 52 | Ga0466711_428622 | 3300042615 | Bacteria | 45121 |
| 53 | Ga0466704_082171 | 3300042643 | Bacteria | 5268 |
| 54 | Ga0104048_1176577 | 3300007143 | Viruses | 979 |
| 55 | Ga0466732_447361 | 3300042656 | Bacteria | 66921 |
| 56 | Ga0466701_030485 | 3300042598 | Bacteria | 1949 |
| 57 | Ga0466706_020771 | 3300042599 | Bacteria | 15999 |
| 58 | Ga0466706_094996 | 3300042599 | Bacteria | 11890 |
| 59 | Ga0466707_260623 | 3300042601 | Bacteria | 26104 |
| 60 | Ga0466713_037159 | 3300042602 | Bacteria | 5402 |
| 61 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 62 | Ga0466722_073992 | 3300042609 | Bacteria | 7758 |
| 63 | Ga0466691_119415 | 3300042593 | Bacteria | 17416 |
| 64 | Ga0466696_088903 | 3300042596 | Bacteria | 11244 |
| 65 | Ga0466696_423060 | 3300042596 | Bacteria | 14772 |
| 66 | Ga0466696_491702 | 3300042596 | Bacteria | 1336 |
| 67 | Ga0123353_10405224 | 3300010167 | Bacteria | 2028 |
| 68 | Ga0123354_10681709 | 3300010882 | Unclassified | 724 |
| 69 | Ga0466715_140819 | 3300042616 | Bacteria | 7165 |
| 70 | Ga0466728_139318 | 3300042620 | Bacteria | 53765 |
| 71 | Ga0466728_250639 | 3300042620 | Bacteria | 1345 |
| 72 | Ga0466704_309403 | 3300042643 | Bacteria | 34772 |
| 73 | JGI24702J35022_10025947 | 3300002462 | Bacteria | 3160 |
| 74 | JGI24696J40584_12957299 | 3300002834 | Bacteria | 3447 |
| 75 | Ga0068305_10335350 | 3300005083 | Bacteria | 1077 |
| 76 | Ga0466700_216950 | 3300042600 | Bacteria | 8275 |
| 77 | Ga0466713_088179 | 3300042602 | Bacteria | 19340 |
| 78 | Ga0466713_125888 | 3300042602 | Bacteria | 191726 |
| 79 | Ga0466716_101121 | 3300042605 | Bacteria | 3506 |
| 80 | Ga0466722_023668 | 3300042609 | Bacteria | 1938 |
| 81 | Ga0466698_292986 | 3300042610 | Bacteria | 1266 |
| 82 | Ga0466693_134459 | 3300042592 | Bacteria | 1116 |
| 83 | Ga0123357_10532914 | 3300009784 | Bacteria | 950 |
| 84 | Ga0466728_092836 | 3300042620 | Bacteria | 17971 |
| 85 | Ga0466735_121244 | 3300042624 | Bacteria | 1795 |
| 86 | Ga0466730_079553 | 3300042625 | Bacteria | 1481 |
| 87 | Ga0466703_262010 | 3300042636 | Bacteria | 2333 |
| 88 | Ga0466708_161327 | 3300042652 | Bacteria | 12977 |
| 89 | Ga0466708_358932 | 3300042652 | Bacteria | 5364 |
| 90 | Ga0466727_223570 | 3300042655 | Bacteria | 3111 |
| 91 | JGI24705J35276_12201807 | 3300002504 | Bacteria | 1625 |
| 92 | Ga0466705_269715 | 3300042612 | Bacteria | 22152 |
| 93 | Ga0466733_213727 | 3300042659 | Bacteria | 3338 |
| 94 | Ga0466706_054201 | 3300042599 | Bacteria | 6950 |
| 95 | Ga0466719_080241 | 3300042606 | Bacteria | 14299 |
| 96 | Ga0466719_286217 | 3300042606 | Bacteria | 2897 |
| 97 | Ga0466722_236248 | 3300042609 | Bacteria | 1569 |
| 98 | Ga0466699_284434 | 3300042597 | Unclassified | 1004 |
| 99 | Ga0123353_10397654 | 3300010167 | Bacteria | 2052 |
| 100 | Ga0123353_10639620 | 3300010167 | Bacteria | 1509 |
| 101 | Ga0466715_350833 | 3300042616 | Bacteria | 63527 |
| 102 | Ga0466729_289416 | 3300042621 | Bacteria | 4139 |
| 103 | JGI24696J40584_12961203 | 3300002834 | Bacteria | 11971 |
| 104 | Ga0466732_112988 | 3300042656 | Bacteria | 1674 |
| 105 | Ga0466733_111961 | 3300042659 | Bacteria | 105531 |
| 106 | Ga0466701_089291 | 3300042598 | Bacteria | 2135 |
| 107 | Ga0466717_110220 | 3300042604 | Bacteria | 2067 |
| 108 | Ga0466693_440650 | 3300042592 | Bacteria | 2017 |
| 109 | Ga0123356_11754429 | 3300010049 | Bacteria | 771 |
| 110 | Ga0466715_376224 | 3300042616 | Bacteria | 43713 |
| 111 | Ga0466728_318809 | 3300042620 | Bacteria | 56945 |
| 112 | Ga0466729_154492 | 3300042621 | Bacteria | 1256 |
| 113 | Ga0466709_393150 | 3300042648 | Bacteria | 88757 |
| 114 | Ga0466725_355450 | 3300042654 | Bacteria | 39231 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08889 | WbqC | WbqC-like protein family | 45 | 184 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.