Protein Family IF05230
Metagenome
Isolate
157
Members
41
Samples
154
Scaffolds
258.52
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_345523|Ga0466696_345523_9330_10223
- Length
- 297 aa
- Sequence
- MIANIRRFGNGGTRRVRAVETPCPRLVMEGEGIYSVFMRILSWNVNGIRAVEKRGFVSWLAGESPDVLCLQETKAHPDQLSAELISPQSASGDQYTSYWASAQKKGYSGVAVYSRIKPLNLKTRGIEEFDREGRVLQAEFEDFTLISAYFPNSQDGGARLGYKLDFCAAMLELCNTLAAAGRHFVLCGDYNIAHTPIDLARPKENEGNAGYLPEERAWMDAYTAAGHVDTFRHFHPGQGGHYSWWSYRAGARARNVGWRLDYHCVDRAFLPRIRSSIIRPDVGGSDHCPVQIEIKAR
Sample Types
Isolate
1.9%
Metagenome
98.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.3%
Kalotermitidae
34.1%
Unclassified
7.3%
Rhinotermitidae
7.3%
Termopsidae
4.9%
Taxonomy
Archaea
0
Bacteria
152
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 15 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 39 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 40 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10019464 | 3300002449 | Bacteria | 3661 |
| 2 | JGI24695J34938_10005105 | 3300002450 | Bacteria | 8328 |
| 3 | JGI24695J34938_10011888 | 3300002450 | Bacteria | 4653 |
| 4 | Ga0466694_020366 | 3300042594 | Bacteria | 2708 |
| 5 | Ga0466694_053284 | 3300042594 | Bacteria | 9886 |
| 6 | Ga0466694_059516 | 3300042594 | Bacteria | 1742 |
| 7 | Ga0466694_120227 | 3300042594 | Bacteria | 1909 |
| 8 | Ga0466694_239170 | 3300042594 | Bacteria | 3026 |
| 9 | Ga0466696_173994 | 3300042596 | Bacteria | 3673 |
| 10 | Ga0466696_377808 | 3300042596 | Bacteria | 10732 |
| 11 | Ga0466721_219001 | 3300042608 | Bacteria | 1459 |
| 12 | Ga0466731_322815 | 3300042622 | Bacteria | 1149 |
| 13 | Ga0466703_198429 | 3300042636 | Unclassified | 4828 |
| 14 | Ga0466727_203387 | 3300042655 | Unclassified | 3191 |
| 15 | Ga0466727_203874 | 3300042655 | Bacteria | 2510 |
| 16 | Ga0466712_165940 | 3300042614 | Bacteria | 1135 |
| 17 | Ga0466711_097500 | 3300042615 | Bacteria | 8976 |
| 18 | Ga0466715_257439 | 3300042616 | Bacteria | 4424 |
| 19 | Ga0466726_018650 | 3300042619 | Bacteria | 3657 |
| 20 | Ga0123356_11064644 | 3300010049 | Bacteria | 978 |
| 21 | JGI24702J35022_10016219 | 3300002462 | Bacteria | 4084 |
| 22 | Ga0466692_003852 | 3300042591 | Bacteria | 4749 |
| 23 | Ga0466692_155112 | 3300042591 | Bacteria | 4205 |
| 24 | Ga0466694_315626 | 3300042594 | Bacteria | 5472 |
| 25 | Ga0466696_031078 | 3300042596 | Bacteria | 8182 |
| 26 | Ga0466696_429630 | 3300042596 | Bacteria | 1567 |
| 27 | Ga0466719_241378 | 3300042606 | Bacteria | 18710 |
| 28 | Ga0466719_297604 | 3300042606 | Bacteria | 4178 |
| 29 | Ga0466698_372736 | 3300042610 | Bacteria | 1486 |
| 30 | Ga0466705_025341 | 3300042612 | Bacteria | 9526 |
| 31 | Ga0466705_050793 | 3300042612 | Bacteria | 9114 |
| 32 | Ga0466731_150150 | 3300042622 | Bacteria | 73009 |
| 33 | Ga0466704_135516 | 3300042643 | Bacteria | 50760 |
| 34 | Ga0466708_338235 | 3300042652 | Bacteria | 21831 |
| 35 | Ga0466712_315350 | 3300042614 | Bacteria | 11372 |
| 36 | Ga0466723_148440 | 3300042618 | Bacteria | 1481 |
| 37 | Ga0466729_064403 | 3300042621 | Bacteria | 1187 |
| 38 | Ga0466729_105562 | 3300042621 | Bacteria | 1361 |
| 39 | Ga0123355_10026346 | 3300009826 | Bacteria | 9378 |
| 40 | JGI24698J34947_10003969 | 3300002449 | Bacteria | 8047 |
| 41 | JGI24695J34938_10041403 | 3300002450 | Bacteria | 2068 |
| 42 | Ga0415639_006396 | 3300038395 | Bacteria | 4892 |
| 43 | Ga0466690_147652 | 3300042590 | Bacteria | 2308 |
| 44 | Ga0466690_224907 | 3300042590 | Bacteria | 1556 |
| 45 | Ga0466691_009693 | 3300042593 | Bacteria | 32026 |
| 46 | Ga0466696_124476 | 3300042596 | Bacteria | 5235 |
| 47 | Ga0466700_193849 | 3300042600 | Bacteria | 35866 |
| 48 | Ga0466717_012199 | 3300042604 | Bacteria | 1194 |
| 49 | Ga0466719_037913 | 3300042606 | Bacteria | 4343 |
| 50 | Ga0466719_372512 | 3300042606 | Bacteria | 6076 |
| 51 | Ga0466720_034222 | 3300042607 | Bacteria | 5430 |
| 52 | Ga0466720_035609 | 3300042607 | Bacteria | 50299 |
| 53 | Ga0466721_355839 | 3300042608 | Bacteria | 31930 |
| 54 | Ga0466731_250435 | 3300042622 | Bacteria | 10404 |
| 55 | Ga0466704_313669 | 3300042643 | Bacteria | 6648 |
| 56 | Ga0466708_119546 | 3300042652 | Bacteria | 3448 |
| 57 | Ga0466727_232891 | 3300042655 | Bacteria | 9080 |
| 58 | Ga0466715_150653 | 3300042616 | Bacteria | 4096 |
| 59 | Ga0466715_576323 | 3300042616 | Bacteria | 4655 |
| 60 | Ga0466726_020940 | 3300042619 | Bacteria | 3250 |
| 61 | Ga0466726_174392 | 3300042619 | Bacteria | 2496 |
| 62 | Ga0466728_070228 | 3300042620 | Bacteria | 9479 |
| 63 | JGI24698J34947_10016809 | 3300002449 | Bacteria | 3969 |
| 64 | JGI24698J34947_10035208 | 3300002449 | Bacteria | 2616 |
| 65 | JGI24695J34938_10000071 | 3300002450 | Bacteria | 85834 |
| 66 | Ga0466696_121563 | 3300042596 | Bacteria | 3864 |
| 67 | Ga0466720_103332 | 3300042607 | Bacteria | 19536 |
| 68 | Ga0466722_123041 | 3300042609 | Bacteria | 3613 |
| 69 | Ga0466703_116357 | 3300042636 | Bacteria | 4709 |
| 70 | Ga0466703_121549 | 3300042636 | Bacteria | 10488 |
| 71 | Ga0466704_024949 | 3300042643 | Bacteria | 10853 |
| 72 | Ga0466709_285098 | 3300042648 | Bacteria | 15718 |
| 73 | Ga0466727_233743 | 3300042655 | Bacteria | 1255 |
| 74 | Ga0466723_028558 | 3300042618 | Bacteria | 1054 |
| 75 | Ga0466723_095891 | 3300042618 | Bacteria | 3992 |
| 76 | Ga0466723_103018 | 3300042618 | Bacteria | 6515 |
| 77 | Ga0123356_10008846 | 3300010049 | Bacteria | 9970 |
| 78 | JGI24698J34947_10060050 | 3300002449 | Unclassified | 1877 |
| 79 | JGI24698J34947_10065912 | 3300002449 | Bacteria | 1764 |
| 80 | JGI24695J34938_10016936 | 3300002450 | Bacteria | 3690 |
| 81 | Ga0466732_146338 | 3300042656 | Bacteria | 27148 |
| 82 | Ga0466690_068180 | 3300042590 | Unclassified | 1534 |
| 83 | Ga0466719_159869 | 3300042606 | Bacteria | 2900 |
| 84 | Ga0466719_523903 | 3300042606 | Bacteria | 4752 |
| 85 | Ga0466720_109732 | 3300042607 | Bacteria | 9099 |
| 86 | Ga0466720_165845 | 3300042607 | Bacteria | 11928 |
| 87 | Ga0466722_062823 | 3300042609 | Bacteria | 9032 |
| 88 | Ga0466704_312200 | 3300042643 | Bacteria | 21732 |
| 89 | Ga0466708_114067 | 3300042652 | Bacteria | 17228 |
| 90 | Ga0466727_171479 | 3300042655 | Bacteria | 3580 |
| 91 | Ga0466705_460934 | 3300042612 | Bacteria | 6920 |
| 92 | Ga0466705_495037 | 3300042612 | Bacteria | 3822 |
| 93 | Ga0466711_317584 | 3300042615 | Bacteria | 1565 |
| 94 | Ga0466715_214076 | 3300042616 | Bacteria | 7674 |
| 95 | Ga0466726_083972 | 3300042619 | Bacteria | 2061 |
| 96 | Ga0466728_296618 | 3300042620 | Bacteria | 5191 |
| 97 | Ga0123356_10012150 | 3300010049 | Bacteria | 8369 |
| 98 | Ga0123353_10330307 | 3300010167 | Bacteria | 2308 |
| 99 | JGI24695J34938_10000802 | 3300002450 | Bacteria | 29173 |
| 100 | JGI24695J34938_10040913 | 3300002450 | Bacteria | 2084 |
| 101 | Ga0466690_141739 | 3300042590 | Bacteria | 4215 |
| 102 | Ga0466691_048435 | 3300042593 | Bacteria | 5537 |
| 103 | Ga0466716_131138 | 3300042605 | Bacteria | 4854 |
| 104 | Ga0466720_030592 | 3300042607 | Bacteria | 15558 |
| 105 | Ga0466722_022732 | 3300042609 | Bacteria | 1965 |
| 106 | Ga0466722_194170 | 3300042609 | Bacteria | 4835 |
| 107 | Ga0466722_263451 | 3300042609 | Bacteria | 3280 |
| 108 | Ga0466698_511560 | 3300042610 | Bacteria | 1293 |
| 109 | Ga0466705_019469 | 3300042612 | Bacteria | 3236 |
| 110 | Ga0466705_270355 | 3300042612 | Bacteria | 2202 |
| 111 | Ga0466731_279652 | 3300042622 | Bacteria | 1375 |
| 112 | Ga0466709_205886 | 3300042648 | Bacteria | 2928 |
| 113 | Ga0466727_091059 | 3300042655 | Bacteria | 4679 |
| 114 | Ga0466727_118057 | 3300042655 | Bacteria | 2162 |
| 115 | Ga0466712_190974 | 3300042614 | Bacteria | 38196 |
| 116 | Ga0466715_144070 | 3300042616 | Bacteria | 26077 |
| 117 | Ga0466723_175764 | 3300042618 | Bacteria | 13311 |
| 118 | Ga0466723_207644 | 3300042618 | Bacteria | 1877 |
| 119 | Ga0466726_183593 | 3300042619 | Bacteria | 1676 |
| 120 | Ga0466728_353307 | 3300042620 | Bacteria | 4360 |
| 121 | Ga0466728_354183 | 3300042620 | Unclassified | 2298 |
| 122 | Ga0123356_10580294 | 3300010049 | Bacteria | 1284 |
| 123 | AustNasuHG_c1004919 | 3300000089 | Bacteria | 4783 |
| 124 | JGI24695J34938_10000723 | 3300002450 | Bacteria | 31147 |
| 125 | JGI24695J34938_10028391 | 3300002450 | Bacteria | 2630 |
| 126 | Ga0466690_256633 | 3300042590 | Bacteria | 4560 |
| 127 | Ga0466691_111577 | 3300042593 | Bacteria | 18596 |
| 128 | Ga0466696_345523 | 3300042596 | Bacteria | 48190 |
| 129 | Ga0466719_503176 | 3300042606 | Bacteria | 10374 |
| 130 | Ga0466698_003197 | 3300042610 | Bacteria | 17033 |
| 131 | Ga0466731_369634 | 3300042622 | Bacteria | 1324 |
| 132 | Ga0466704_056475 | 3300042643 | Bacteria | 4132 |
| 133 | Ga0466709_350672 | 3300042648 | Bacteria | 2342 |
| 134 | Ga0466708_054239 | 3300042652 | Bacteria | 6066 |
| 135 | Ga0466727_346017 | 3300042655 | Bacteria | 3441 |
| 136 | Ga0466711_121145 | 3300042615 | Bacteria | 20134 |
| 137 | Ga0466723_031890 | 3300042618 | Bacteria | 1804 |
| 138 | Ga0466726_206607 | 3300042619 | Bacteria | 3381 |
| 139 | Ga0466726_406408 | 3300042619 | Bacteria | 2108 |
| 140 | JGI24695J34938_10000391 | 3300002450 | Bacteria | 43169 |
| 141 | JGI24695J34938_10000507 | 3300002450 | Bacteria | 37871 |
| 142 | JGI24695J34938_10001812 | 3300002450 | Bacteria | 17459 |
| 143 | Ga0466699_005819 | 3300042597 | Bacteria | 3017 |
| 144 | Ga0466722_097587 | 3300042609 | Bacteria | 9314 |
| 145 | Ga0466703_007398 | 3300042636 | Bacteria | 2190 |
| 146 | Ga0466703_369341 | 3300042636 | Bacteria | 1249 |
| 147 | Ga0466708_246361 | 3300042652 | Bacteria | 4207 |
| 148 | Ga0466718_036289 | 3300042617 | Bacteria | 1290 |
| 149 | Ga0466718_083400 | 3300042617 | Bacteria | 10236 |
| 150 | Ga0466723_080631 | 3300042618 | Bacteria | 17818 |
| 151 | Ga0466723_086929 | 3300042618 | Bacteria | 10928 |
| 152 | Ga0466728_019829 | 3300042620 | Bacteria | 7158 |
| 153 | Ga0466728_209378 | 3300042620 | Bacteria | 2774 |
| 154 | Ga0123356_10037504 | 3300010049 | Bacteria | 4521 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03372 | Exo_endo_phos | Endonuclease/Exonuclease/phosphatase family | 41 | 287 | 0.89 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03372 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.