Protein Family IF05209
Metagenome
Isolate
139
Members
55
Samples
130
Scaffolds
141.22
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_297252|Ga0466696_297252_405_914
- Length
- 169 aa
- Sequence
- VSFSDEKLERSTLTKHIKSILYLSGGKSKMMKNPAETIGNLIEKQGISFISSIDENGYPNTKAMLPPVKREGIKTFYWHTNSPSMRIKHYRNNPKACIYFYDKRFFRGVMLKGTMEVLDDRKVKKELWKDEFTTYYKDGMDGGDFIIIKFTAEDGRYYSNFHSEDFKIE
Sample Types
Isolate
6.5%
Metagenome
93.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.9%
Kalotermitidae
22.2%
Unclassified
20.4%
Rhinotermitidae
3.7%
Termopsidae
1.9%
Taxonomy
Archaea
3
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2820166269 | Unclassified Proteobacteria Co191P4bin16 | Isolate | Unclassified |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 2820170025 | Unclassified Proteobacteria Co191P1bin43 | Isolate | Unclassified |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 34 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 41 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 42 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 48 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 50 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 51 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 52 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 53 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 54 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 55 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_035333 | 3300042612 | Bacteria | 17587 |
| 2 | Ga0466733_026125 | 3300042659 | Bacteria | 5789 |
| 3 | JGI24698J34947_10109212 | 3300002449 | Bacteria | 1225 |
| 4 | JGI24702J35022_10029297 | 3300002462 | Unclassified | 2955 |
| 5 | Ga0466693_439729 | 3300042592 | Bacteria | 2347 |
| 6 | Ga0466694_153287 | 3300042594 | Unclassified | 2273 |
| 7 | Ga0466694_257468 | 3300042594 | Bacteria | 3093 |
| 8 | Ga0123356_13454333 | 3300010049 | Bacteria | 548 |
| 9 | Ga0123354_10313036 | 3300010882 | Bacteria | 1462 |
| 10 | JGI24702J35022_10498515 | 3300002462 | Bacteria | 746 |
| 11 | Ga0072941_1033444 | 3300005201 | Bacteria | 1119 |
| 12 | Ga0466734_085032 | 3300042623 | Bacteria | 1068 |
| 13 | Ga0466703_216800 | 3300042636 | Bacteria | 8457 |
| 14 | Ga0466709_289692 | 3300042648 | Bacteria | 1437 |
| 15 | Ga0466690_132358 | 3300042590 | Unclassified | 6041 |
| 16 | Ga0466693_189590 | 3300042592 | Archaea | 1448 |
| 17 | Ga0466691_054270 | 3300042593 | Bacteria | 2680 |
| 18 | Ga0466694_308555 | 3300042594 | Bacteria | 1099 |
| 19 | Ga0466696_336620 | 3300042596 | Bacteria | 1455 |
| 20 | Ga0466699_095417 | 3300042597 | Bacteria | 3901 |
| 21 | Ga0466699_139225 | 3300042597 | Bacteria | 1148 |
| 22 | Ga0123353_10184475 | 3300010167 | Unclassified | 3300 |
| 23 | Ga0466712_175202 | 3300042614 | Archaea | 1879 |
| 24 | Ga0466712_257943 | 3300042614 | Bacteria | 1048 |
| 25 | Ga0466712_308374 | 3300042614 | Bacteria | 1205 |
| 26 | Ga0466715_644943 | 3300042616 | Unclassified | 1851 |
| 27 | Ga0466718_053412 | 3300042617 | Bacteria | 1862 |
| 28 | Ga0466723_003472 | 3300042618 | Bacteria | 2638 |
| 29 | Ga0466726_215141 | 3300042619 | Bacteria | 1337 |
| 30 | Ga0466719_058671 | 3300042606 | Bacteria | 1987 |
| 31 | Ga0466719_331645 | 3300042606 | Bacteria | 1046 |
| 32 | JGI24695J34938_10009290 | 3300002450 | Bacteria | 5481 |
| 33 | JGI24695J34938_10121562 | 3300002450 | Bacteria | 1063 |
| 34 | JGI24699J35502_11128913 | 3300002509 | Unclassified | 4541 |
| 35 | Ga0456237_0033414 | 3300041968 | Bacteria | 687 |
| 36 | Ga0466712_028702 | 3300042614 | Bacteria | 2196 |
| 37 | Ga0466718_002292 | 3300042617 | Bacteria | 2946 |
| 38 | Ga0466718_166815 | 3300042617 | Bacteria | 4285 |
| 39 | Ga0466698_043363 | 3300042610 | Bacteria | 1509 |
| 40 | Ga0466698_516225 | 3300042610 | Bacteria | 1060 |
| 41 | AustNasuHG_c1030442 | 3300000089 | Unclassified | 1553 |
| 42 | JGI24695J34938_10158308 | 3300002450 | Bacteria | 930 |
| 43 | JGI24702J35022_10003830 | 3300002462 | Unclassified | 9025 |
| 44 | JGI24702J35022_10033274 | 3300002462 | Bacteria | 2758 |
| 45 | JGI24705J35276_12194035 | 3300002504 | Bacteria | 1506 |
| 46 | JGI24705J35276_12212753 | 3300002504 | Bacteria | 1900 |
| 47 | JGI24696J40584_12577695 | 3300002834 | Bacteria | 642 |
| 48 | Ga0068305_10017923 | 3300005083 | Bacteria | 2994 |
| 49 | Ga0466731_299525 | 3300042622 | Bacteria | 1641 |
| 50 | Ga0466703_295610 | 3300042636 | Bacteria | 1437 |
| 51 | Ga0466691_135897 | 3300042593 | Bacteria | 2280 |
| 52 | Ga0466696_008377 | 3300042596 | Bacteria | 8659 |
| 53 | Ga0466696_297252 | 3300042596 | Bacteria | 1176 |
| 54 | Ga0466699_282273 | 3300042597 | Bacteria | 1300 |
| 55 | Ga0123353_11764501 | 3300010167 | Bacteria | 771 |
| 56 | Ga0466712_021946 | 3300042614 | Bacteria | 5962 |
| 57 | Ga0466712_046367 | 3300042614 | Bacteria | 2653 |
| 58 | Ga0466712_208852 | 3300042614 | Bacteria | 6962 |
| 59 | Ga0466712_303060 | 3300042614 | Unclassified | 1744 |
| 60 | Ga0466718_134056 | 3300042617 | Unclassified | 4509 |
| 61 | Ga0466700_268441 | 3300042600 | Bacteria | 1633 |
| 62 | Ga0466707_355149 | 3300042601 | Bacteria | 1083 |
| 63 | Ga0466717_091590 | 3300042604 | Bacteria | 2081 |
| 64 | Ga0466719_012761 | 3300042606 | Bacteria | 8310 |
| 65 | Ga0466698_348492 | 3300042610 | Bacteria | 1314 |
| 66 | Ga0466732_434304 | 3300042656 | Bacteria | 1566 |
| 67 | JGI24698J34947_10065782 | 3300002449 | Unclassified | 1766 |
| 68 | JGI24698J34947_10110238 | 3300002449 | Unclassified | 1217 |
| 69 | JGI24698J34947_10152774 | 3300002449 | Bacteria | 956 |
| 70 | JGI24702J35022_10015273 | 3300002462 | Bacteria | 4231 |
| 71 | JGI24705J35276_12200537 | 3300002504 | Bacteria | 1603 |
| 72 | Ga0072941_1043313 | 3300005201 | Bacteria | 3334 |
| 73 | Ga0466692_137524 | 3300042591 | Bacteria | 1036 |
| 74 | Ga0466701_013677 | 3300042598 | Bacteria | 1780 |
| 75 | Ga0123356_10000360 | 3300010049 | Bacteria | 51711 |
| 76 | Ga0466718_113510 | 3300042617 | Bacteria | 1072 |
| 77 | Ga0466723_251345 | 3300042618 | Bacteria | 1071 |
| 78 | Ga0466717_036076 | 3300042604 | Bacteria | 3294 |
| 79 | Ga0466721_015084 | 3300042608 | Bacteria | 2297 |
| 80 | JGI24698J34947_10016990 | 3300002449 | Archaea | 3947 |
| 81 | JGI24698J34947_10222174 | 3300002449 | Unclassified | 724 |
| 82 | JGI24702J35022_10077980 | 3300002462 | Bacteria | 1792 |
| 83 | JGI24702J35022_10311619 | 3300002462 | Bacteria | 931 |
| 84 | JGI24697J35500_10700309 | 3300002507 | Bacteria | 640 |
| 85 | JGI24696J40584_12958384 | 3300002834 | Bacteria | 4094 |
| 86 | Ga0466703_229004 | 3300042636 | Bacteria | 1764 |
| 87 | Ga0466704_531763 | 3300042643 | Bacteria | 1183 |
| 88 | Ga0466693_236615 | 3300042592 | Unclassified | 3304 |
| 89 | Ga0466694_009587 | 3300042594 | Bacteria | 21066 |
| 90 | Ga0123356_10423313 | 3300010049 | Bacteria | 1474 |
| 91 | Ga0466712_005377 | 3300042614 | Bacteria | 7270 |
| 92 | Ga0466712_144401 | 3300042614 | Unclassified | 3986 |
| 93 | Ga0466711_452005 | 3300042615 | Bacteria | 1602 |
| 94 | Ga0466715_335955 | 3300042616 | Bacteria | 1119 |
| 95 | Ga0466707_149048 | 3300042601 | Bacteria | 1368 |
| 96 | Ga0466717_103462 | 3300042604 | Bacteria | 1800 |
| 97 | Ga0466719_000679 | 3300042606 | Unclassified | 1389 |
| 98 | Ga0466719_087147 | 3300042606 | Bacteria | 1066 |
| 99 | JGI24698J34947_10043196 | 3300002449 | Bacteria | 2312 |
| 100 | JGI24695J34938_10064123 | 3300002450 | Bacteria | 1555 |
| 101 | JGI24702J35022_10357305 | 3300002462 | Bacteria | 874 |
| 102 | JGI24705J35276_12097206 | 3300002504 | Bacteria | 1009 |
| 103 | Ga0466703_206285 | 3300042636 | Bacteria | 1717 |
| 104 | Ga0466692_192402 | 3300042591 | Bacteria | 1474 |
| 105 | Ga0466694_185859 | 3300042594 | Bacteria | 9745 |
| 106 | Ga0466696_305177 | 3300042596 | Unclassified | 2026 |
| 107 | Ga0123353_10488997 | 3300010167 | Unclassified | 1798 |
| 108 | Ga0466710_228966 | 3300042613 | Bacteria | 1113 |
| 109 | Ga0466711_484952 | 3300042615 | Bacteria | 1132 |
| 110 | Ga0466715_193277 | 3300042616 | Bacteria | 9457 |
| 111 | Ga0466698_396596 | 3300042610 | Bacteria | 1640 |
| 112 | Ga0466733_076681 | 3300042659 | Bacteria | 6510 |
| 113 | JGI24698J34947_10031792 | 3300002449 | Bacteria | 2775 |
| 114 | JGI24698J34947_10043205 | 3300002449 | Bacteria | 2312 |
| 115 | JGI24702J35022_10000819 | 3300002462 | Bacteria | 19235 |
| 116 | JGI24697J35500_11265636 | 3300002507 | Unclassified | 3428 |
| 117 | Ga0072940_1014448 | 3300005200 | Bacteria | 1854 |
| 118 | Ga0466709_246949 | 3300042648 | Bacteria | 8687 |
| 119 | Ga0466691_007521 | 3300042593 | Bacteria | 9142 |
| 120 | Ga0466694_189530 | 3300042594 | Bacteria | 2251 |
| 121 | Ga0466696_196626 | 3300042596 | Bacteria | 7243 |
| 122 | Ga0466712_011783 | 3300042614 | Bacteria | 1692 |
| 123 | Ga0466712_121311 | 3300042614 | Bacteria | 5172 |
| 124 | Ga0466712_303795 | 3300042614 | Bacteria | 2278 |
| 125 | Ga0466715_143170 | 3300042616 | Bacteria | 3889 |
| 126 | Ga0466728_308725 | 3300042620 | Bacteria | 3280 |
| 127 | Ga0466701_071740 | 3300042598 | Bacteria | 1140 |
| 128 | Ga0466720_055863 | 3300042607 | Bacteria | 2676 |
| 129 | Ga0466698_013164 | 3300042610 | Bacteria | 1520 |
| 130 | Ga0466698_083134 | 3300042610 | Bacteria | 2475 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042594 | Ga0466694_153287 | Ga0466694_153287_689_1105 | 138 |
| 2 | 3300042597 | Ga0466699_095417 | Ga0466699_095417_2214_2630 | 138 |
| 3 | 3300042604 | Ga0466717_036076 | Ga0466717_036076_2490_2906 | 138 |
| 4 | 3300042615 | Ga0466711_452005 | Ga0466711_452005_208_624 | 138 |
| 5 | 3300010167 | Ga0123353_10488997 | Ga0123353_104889972 | 139 |
| 6 | 3300042594 | Ga0466694_009587 | Ga0466694_009587_8106_8525 | 139 |
| 7 | 3300042598 | Ga0466701_013677 | Ga0466701_013677_686_1105 | 139 |
| 8 | 3300042614 | Ga0466712_021946 | Ga0466712_021946_5150_5569 | 139 |
| 9 | 3300042614 | Ga0466712_121311 | Ga0466712_121311_705_1124 | 139 |
| 10 | 3300042617 | Ga0466718_002292 | Ga0466718_002292_1112_1531 | 139 |
| 11 | 3300042617 | Ga0466718_053412 | Ga0466718_053412_209_628 | 139 |
| 12 | 3300042617 | Ga0466718_166815 | Ga0466718_166815_1500_1919 | 139 |
| 13 | 3300042622 | Ga0466731_299525 | Ga0466731_299525_99_518 | 139 |
| 14 | 3300042648 | Ga0466709_289692 | Ga0466709_289692_382_801 | 139 |
| 15 | 3300042659 | Ga0466733_076681 | Ga0466733_076681_2943_3362 | 139 |
| 16 | iso_pr_bacteria | 2781125629 | 2781264302 | 139 |
| 17 | 3300002449 | JGI24698J34947_10016990 | JGI24698J34947_100169903 | 140 |
| 18 | 3300002449 | JGI24698J34947_10031792 | JGI24698J34947_100317922 | 140 |
| 19 | 3300002449 | JGI24698J34947_10043196 | JGI24698J34947_100431963 | 140 |
| 20 | 3300002449 | JGI24698J34947_10065782 | JGI24698J34947_100657822 | 140 |
| 21 | 3300002449 | JGI24698J34947_10109212 | JGI24698J34947_101092122 | 140 |
| 22 | 3300002449 | JGI24698J34947_10152774 | JGI24698J34947_101527742 | 140 |
| 23 | 3300002462 | JGI24702J35022_10015273 | JGI24702J35022_100152732 | 140 |
| 24 | 3300002462 | JGI24702J35022_10357305 | JGI24702J35022_103573051 | 140 |
| 25 | 3300002504 | JGI24705J35276_12200537 | JGI24705J35276_122005371 | 140 |
| 26 | 3300002509 | JGI24699J35502_11128913 | JGI24699J35502_111289134 | 140 |
| 27 | 3300002834 | JGI24696J40584_12577695 | JGI24696J40584_125776952 | 140 |
| 28 | 3300002834 | JGI24696J40584_12958384 | JGI24696J40584_129583844 | 140 |
| 29 | 3300005201 | Ga0072941_1033444 | Ga0072941_10334442 | 140 |
| 30 | 3300010049 | Ga0123356_10423313 | Ga0123356_104233133 | 140 |
| 31 | 3300010167 | Ga0123353_11764501 | Ga0123353_117645012 | 140 |
| 32 | 3300042591 | Ga0466692_137524 | Ga0466692_137524_414_836 | 140 |
| 33 | 3300042591 | Ga0466692_192402 | Ga0466692_192402_422_844 | 140 |
| 34 | 3300042592 | Ga0466693_189590 | Ga0466693_189590_152_574 | 140 |
| 35 | 3300042592 | Ga0466693_439729 | Ga0466693_439729_333_755 | 140 |
| 36 | 3300042593 | Ga0466691_007521 | Ga0466691_007521_1119_1541 | 140 |
| 37 | 3300042593 | Ga0466691_054270 | Ga0466691_054270_1927_2349 | 140 |
| 38 | 3300042594 | Ga0466694_189530 | Ga0466694_189530_1024_1446 | 140 |
| 39 | 3300042594 | Ga0466694_257468 | Ga0466694_257468_1519_1941 | 140 |
| 40 | 3300042594 | Ga0466694_308555 | Ga0466694_308555_424_846 | 140 |
| 41 | 3300042596 | Ga0466696_008377 | Ga0466696_008377_532_954 | 140 |
| 42 | 3300042596 | Ga0466696_305177 | Ga0466696_305177_1158_1580 | 140 |
| 43 | 3300042596 | Ga0466696_336620 | Ga0466696_336620_120_542 | 140 |
| 44 | 3300042597 | Ga0466699_139225 | Ga0466699_139225_659_1081 | 140 |
| 45 | 3300042598 | Ga0466701_071740 | Ga0466701_071740_529_951 | 140 |
| 46 | 3300042600 | Ga0466700_268441 | Ga0466700_268441_677_1099 | 140 |
| 47 | 3300042601 | Ga0466707_149048 | Ga0466707_149048_512_934 | 140 |
| 48 | 3300042601 | Ga0466707_355149 | Ga0466707_355149_257_679 | 140 |
| 49 | 3300042604 | Ga0466717_091590 | Ga0466717_091590_133_555 | 140 |
| 50 | 3300042606 | Ga0466719_000679 | Ga0466719_000679_133_555 | 140 |
| 51 | 3300042606 | Ga0466719_012761 | Ga0466719_012761_2906_3328 | 140 |
| 52 | 3300042606 | Ga0466719_087147 | Ga0466719_087147_455_877 | 140 |
| 53 | 3300042606 | Ga0466719_331645 | Ga0466719_331645_473_895 | 140 |
| 54 | 3300042607 | Ga0466720_055863 | Ga0466720_055863_2097_2519 | 140 |
| 55 | 3300042610 | Ga0466698_013164 | Ga0466698_013164_199_621 | 140 |
| 56 | 3300042610 | Ga0466698_043363 | Ga0466698_043363_946_1368 | 140 |
| 57 | 3300042610 | Ga0466698_083134 | Ga0466698_083134_2004_2426 | 140 |
| 58 | 3300042610 | Ga0466698_396596 | Ga0466698_396596_10_432 | 140 |
| 59 | 3300042610 | Ga0466698_516225 | Ga0466698_516225_71_493 | 140 |
| 60 | 3300042612 | Ga0466705_035333 | Ga0466705_035333_4623_5045 | 140 |
| 61 | 3300042613 | Ga0466710_228966 | Ga0466710_228966_89_511 | 140 |
| 62 | 3300042614 | Ga0466712_011783 | Ga0466712_011783_373_795 | 140 |
| 63 | 3300042614 | Ga0466712_028702 | Ga0466712_028702_1126_1548 | 140 |
| 64 | 3300042614 | Ga0466712_046367 | Ga0466712_046367_1079_1501 | 140 |
| 65 | 3300042614 | Ga0466712_144401 | Ga0466712_144401_17_439 | 140 |
| 66 | 3300042614 | Ga0466712_175202 | Ga0466712_175202_919_1341 | 140 |
| 67 | 3300042614 | Ga0466712_208852 | Ga0466712_208852_4225_4647 | 140 |
| 68 | 3300042614 | Ga0466712_257943 | Ga0466712_257943_71_493 | 140 |
| 69 | 3300042614 | Ga0466712_303060 | Ga0466712_303060_304_726 | 140 |
| 70 | 3300042614 | Ga0466712_303795 | Ga0466712_303795_852_1274 | 140 |
| 71 | 3300042614 | Ga0466712_308374 | Ga0466712_308374_415_837 | 140 |
| 72 | 3300042615 | Ga0466711_484952 | Ga0466711_484952_405_827 | 140 |
| 73 | 3300042616 | Ga0466715_143170 | Ga0466715_143170_1913_2335 | 140 |
| 74 | 3300042616 | Ga0466715_193277 | Ga0466715_193277_8814_9236 | 140 |
| 75 | 3300042616 | Ga0466715_335955 | Ga0466715_335955_172_594 | 140 |
| 76 | 3300042616 | Ga0466715_644943 | Ga0466715_644943_947_1369 | 140 |
| 77 | 3300042617 | Ga0466718_113510 | Ga0466718_113510_169_591 | 140 |
| 78 | 3300042617 | Ga0466718_134056 | Ga0466718_134056_1361_1783 | 140 |
| 79 | 3300042619 | Ga0466726_215141 | Ga0466726_215141_654_1076 | 140 |
| 80 | 3300042620 | Ga0466728_308725 | Ga0466728_308725_2501_2923 | 140 |
| 81 | 3300042623 | Ga0466734_085032 | Ga0466734_085032_401_823 | 140 |
| 82 | 3300042636 | Ga0466703_216800 | Ga0466703_216800_5919_6341 | 140 |
| 83 | 3300042636 | Ga0466703_229004 | Ga0466703_229004_1299_1721 | 140 |
| 84 | 3300042636 | Ga0466703_295610 | Ga0466703_295610_189_611 | 140 |
| 85 | 3300042648 | Ga0466709_246949 | Ga0466709_246949_1184_1606 | 140 |
| 86 | 3300042656 | Ga0466732_434304 | Ga0466732_434304_941_1363 | 140 |
| 87 | iso_pr_bacteria | 2781125652 | 2781312643 | 140 |
| 88 | iso_pr_bacteria | 2781125689 | 2781425715 | 140 |
| 89 | iso_pr_bacteria | 2819998259 | 2819999396 | 140 |
| 90 | iso_pr_bacteria | 2820016619 | 2820017047 | 140 |
| 91 | iso_pr_bacteria | 2820166269 | 2820166669 | 140 |
| 92 | iso_pr_bacteria | 2820170025 | 2820171682 | 140 |
| 93 | iso_pr_bacteria | 2820246658 | 2820247678 | 140 |
| 94 | iso_pr_bacteria | 2820737921 | 2820738039 | 140 |
| 95 | 3300000089 | AustNasuHG_c1030442 | AustNasuHG_10304423 | 141 |
| 96 | 3300002449 | JGI24698J34947_10110238 | JGI24698J34947_101102382 | 141 |
| 97 | 3300002449 | JGI24698J34947_10222174 | JGI24698J34947_102221742 | 141 |
| 98 | 3300002450 | JGI24695J34938_10009290 | JGI24695J34938_100092905 | 141 |
| 99 | 3300002450 | JGI24695J34938_10064123 | JGI24695J34938_100641232 | 141 |
| 100 | 3300002450 | JGI24695J34938_10121562 | JGI24695J34938_101215622 | 141 |
| 101 | 3300002450 | JGI24695J34938_10158308 | JGI24695J34938_101583081 | 141 |
| 102 | 3300002462 | JGI24702J35022_10000819 | JGI24702J35022_1000081911 | 141 |
| 103 | 3300002462 | JGI24702J35022_10003830 | JGI24702J35022_100038304 | 141 |
| 104 | 3300002462 | JGI24702J35022_10029297 | JGI24702J35022_100292974 | 141 |
| 105 | 3300002462 | JGI24702J35022_10033274 | JGI24702J35022_100332742 | 141 |
| 106 | 3300002462 | JGI24702J35022_10077980 | JGI24702J35022_100779802 | 141 |
| 107 | 3300002462 | JGI24702J35022_10311619 | JGI24702J35022_103116192 | 141 |
| 108 | 3300002462 | JGI24702J35022_10498515 | JGI24702J35022_104985151 | 141 |
| 109 | 3300002504 | JGI24705J35276_12097206 | JGI24705J35276_120972062 | 141 |
| 110 | 3300002504 | JGI24705J35276_12212753 | JGI24705J35276_122127532 | 141 |
| 111 | 3300002507 | JGI24697J35500_10700309 | JGI24697J35500_107003091 | 141 |
| 112 | 3300002507 | JGI24697J35500_11265636 | JGI24697J35500_112656364 | 141 |
| 113 | 3300005200 | Ga0072940_1014448 | Ga0072940_10144482 | 141 |
| 114 | 3300005201 | Ga0072941_1043313 | Ga0072941_10433133 | 141 |
| 115 | 3300010049 | Ga0123356_13454333 | Ga0123356_134543332 | 141 |
| 116 | 3300010167 | Ga0123353_10184475 | Ga0123353_101844751 | 141 |
| 117 | 3300042590 | Ga0466690_132358 | Ga0466690_132358_5409_5834 | 141 |
| 118 | 3300042594 | Ga0466694_185859 | Ga0466694_185859_2211_2636 | 141 |
| 119 | 3300042592 | Ga0466693_236615 | Ga0466693_236615_25_453 | 142 |
| 120 | 3300042606 | Ga0466719_058671 | Ga0466719_058671_453_881 | 142 |
| 121 | 3300042614 | Ga0466712_005377 | Ga0466712_005377_5679_6107 | 142 |
| 122 | 3300042643 | Ga0466704_531763 | Ga0466704_531763_390_818 | 142 |
| 123 | 3300042659 | Ga0466733_026125 | Ga0466733_026125_1299_1727 | 142 |
| 124 | 3300002449 | JGI24698J34947_10043205 | JGI24698J34947_100432056 | 143 |
| 125 | 3300002504 | JGI24705J35276_12194035 | JGI24705J35276_121940352 | 143 |
| 126 | 3300005083 | Ga0068305_10017923 | Ga0068305_100179235 | 143 |
| 127 | 3300041968 | Ga0456237_0033414 | Ga0456237_0033414_159_596 | 145 |
| 128 | 3300042593 | Ga0466691_135897 | Ga0466691_135897_179_616 | 145 |
| 129 | 3300042597 | Ga0466699_282273 | Ga0466699_282273_476_913 | 145 |
| 130 | 3300042604 | Ga0466717_103462 | Ga0466717_103462_1233_1670 | 145 |
| 131 | 3300042636 | Ga0466703_206285 | Ga0466703_206285_814_1251 | 145 |
| 132 | 3300010882 | Ga0123354_10313036 | Ga0123354_103130362 | 147 |
| 133 | 3300042610 | Ga0466698_348492 | Ga0466698_348492_357_800 | 147 |
| 134 | 3300042618 | Ga0466723_251345 | Ga0466723_251345_162_608 | 148 |
| 135 | 3300010049 | Ga0123356_10000360 | Ga0123356_100003603 | 153 |
| 136 | 3300042596 | Ga0466696_196626 | Ga0466696_196626_1675_2142 | 155 |
| 137 | 3300042608 | Ga0466721_015084 | Ga0466721_015084_402_887 | 161 |
| 138 | 3300042618 | Ga0466723_003472 | Ga0466723_003472_1003_1488 | 161 |
| 139 | 3300042596 | Ga0466696_297252 | Ga0466696_297252_405_914 | 169 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.78 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.