Protein Family IF05177
Metagenome
Metatranscriptome
Isolate
174
Members
53
Samples
166
Scaffolds
334.48
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_198532|Ga0466696_198532_534_1688
- Length
- 384 aa
- Sequence
- MVDAAGRPRSPDDAAGMPARMFPCIILPGVMSSREFTTTFCIFPVFETQGERIMDFARAMKEKAKNLQRRIVLPEGSEERTIAAAVELVKHQYAKEVTLLATRDAVVKNARGADLNGITIIDPETSEWLPEFAEEYHKIRKHKGMTPERAADEIRHFMRFGAMMTRLGKTDALVSGALSPTADVLRAGLTIIGTANNIGTASSCFIMDTHNEKWGADGLLAFADCAVIPVPTAEQLGDIAVASAATFNSLVGAEPVVAMLSFSTKGSGGNHENVLRVQEGVRLARQKAPNLLLDGELQADAALIPAITERKAPGSPITGKVNTLVFPDLGAGNIAYKLAQRLAGADAFGPFLQGFAKPISDLSRGCSVEDIVVTSCVTMVQSAK
Sample Types
Isolate
4.6%
Metagenome
94.8%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.2%
Kalotermitidae
23.5%
Unclassified
15.7%
Termopsidae
7.8%
Rhinotermitidae
5.9%
Blaberidae
2.0%
Blattidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
0
Bacteria
162
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 14 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 24 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 25 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 33 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 34 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 35 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 43 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 44 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 45 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 47 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 48 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 49 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_048675 | 3300042656 | Bacteria | 2444 |
| 2 | Ga0466707_307704 | 3300042601 | Bacteria | 5527 |
| 3 | Ga0466707_419534 | 3300042601 | Bacteria | 1323 |
| 4 | Ga0466716_115049 | 3300042605 | Bacteria | 6172 |
| 5 | Ga0466722_053432 | 3300042609 | Bacteria | 9687 |
| 6 | Ga0466708_176095 | 3300042652 | Bacteria | 8890 |
| 7 | Ga0264413_100179 | 3300024493 | Bacteria | 5233 |
| 8 | Ga0123356_10649976 | 3300010049 | Bacteria | 1222 |
| 9 | JGI24698J34947_10001995 | 3300002449 | Bacteria | 10890 |
| 10 | JGI24695J34938_10003202 | 3300002450 | Bacteria | 11607 |
| 11 | JGI24695J34938_10003889 | 3300002450 | Bacteria | 10116 |
| 12 | JGI24695J34938_10010244 | 3300002450 | Bacteria | 5151 |
| 13 | Ga0466712_023314 | 3300042614 | Bacteria | 24763 |
| 14 | Ga0466712_031793 | 3300042614 | Bacteria | 8895 |
| 15 | Ga0466715_208520 | 3300042616 | Bacteria | 7173 |
| 16 | Ga0466718_162596 | 3300042617 | Bacteria | 1422 |
| 17 | Ga0466726_126065 | 3300042619 | Bacteria | 5069 |
| 18 | Ga0466726_164701 | 3300042619 | Bacteria | 2041 |
| 19 | Ga0466729_189439 | 3300042621 | Bacteria | 1283 |
| 20 | Ga0466705_250564 | 3300042612 | Bacteria | 23311 |
| 21 | Ga0466732_144802 | 3300042656 | Bacteria | 5685 |
| 22 | Ga0466716_425661 | 3300042605 | Bacteria | 7929 |
| 23 | Ga0466698_354032 | 3300042610 | Bacteria | 2899 |
| 24 | Ga0466703_065838 | 3300042636 | Bacteria | 3868 |
| 25 | Ga0466708_047304 | 3300042652 | Bacteria | 2703 |
| 26 | Ga0466692_094525 | 3300042591 | Bacteria | 1413 |
| 27 | Ga0466691_096476 | 3300042593 | Bacteria | 40620 |
| 28 | Ga0123356_10004424 | 3300010049 | Bacteria | 14526 |
| 29 | JGI24698J34947_10009663 | 3300002449 | Bacteria | 5286 |
| 30 | JGI24695J34938_10008681 | 3300002450 | Unclassified | 5771 |
| 31 | Ga0072941_1014833 | 3300005201 | Bacteria | 12856 |
| 32 | Ga0072941_1109233 | 3300005201 | Bacteria | 4402 |
| 33 | Ga0466712_006862 | 3300042614 | Bacteria | 8984 |
| 34 | Ga0466712_215932 | 3300042614 | Bacteria | 17601 |
| 35 | Ga0466711_130111 | 3300042615 | Bacteria | 5203 |
| 36 | Ga0466711_222912 | 3300042615 | Bacteria | 3130 |
| 37 | Ga0466715_391560 | 3300042616 | Bacteria | 2547 |
| 38 | Ga0466726_170218 | 3300042619 | Bacteria | 4844 |
| 39 | Ga0466726_297763 | 3300042619 | Bacteria | 6440 |
| 40 | Ga0466729_089863 | 3300042621 | Bacteria | 8139 |
| 41 | Ga0466719_075555 | 3300042606 | Bacteria | 2414 |
| 42 | Ga0466719_325990 | 3300042606 | Bacteria | 1934 |
| 43 | Ga0255809_1034345 | 3300022820 | Bacteria | 1217 |
| 44 | Ga0466690_298528 | 3300042590 | Bacteria | 2524 |
| 45 | Ga0466692_177098 | 3300042591 | Bacteria | 5221 |
| 46 | Ga0466693_300718 | 3300042592 | Bacteria | 1295 |
| 47 | Ga0466691_023456 | 3300042593 | Bacteria | 3687 |
| 48 | Ga0466694_107433 | 3300042594 | Bacteria | 13824 |
| 49 | Ga0466694_119196 | 3300042594 | Bacteria | 3234 |
| 50 | Ga0466696_385164 | 3300042596 | Bacteria | 1222 |
| 51 | Ga0123356_10007001 | 3300010049 | Bacteria | 11321 |
| 52 | JGI24698J34947_10008648 | 3300002449 | Bacteria | 5587 |
| 53 | JGI24698J34947_10024995 | 3300002449 | Bacteria | 3183 |
| 54 | JGI24698J34947_10042862 | 3300002449 | Unclassified | 2323 |
| 55 | JGI24698J34947_10097192 | 3300002449 | Bacteria | 1334 |
| 56 | JGI24695J34938_10000014 | 3300002450 | Bacteria | 120713 |
| 57 | JGI24702J35022_10001602 | 3300002462 | Bacteria | 13976 |
| 58 | Ga0072940_1007044 | 3300005200 | Bacteria | 4322 |
| 59 | Ga0466712_034312 | 3300042614 | Bacteria | 11840 |
| 60 | Ga0466712_058223 | 3300042614 | Bacteria | 22691 |
| 61 | Ga0466712_130102 | 3300042614 | Bacteria | 14039 |
| 62 | Ga0466732_237056 | 3300042656 | Bacteria | 2190 |
| 63 | Ga0466733_067829 | 3300042659 | Bacteria | 52214 |
| 64 | Ga0466729_217254 | 3300042621 | Bacteria | 1432 |
| 65 | Ga0466703_044491 | 3300042636 | Bacteria | 1168 |
| 66 | Ga0466727_228847 | 3300042655 | Bacteria | 1987 |
| 67 | Ga0466693_175085 | 3300042592 | Bacteria | 3850 |
| 68 | Ga0466694_330725 | 3300042594 | Bacteria | 2207 |
| 69 | Ga0466695_154177 | 3300042595 | Bacteria | 2601 |
| 70 | Ga0123353_10073778 | 3300010167 | Bacteria | 5485 |
| 71 | IMNBL1DRAFT_c0000926 | 3300000062 | Bacteria | 22662 |
| 72 | JGI24698J34947_10001206 | 3300002449 | Bacteria | 13514 |
| 73 | JGI24698J34947_10002056 | 3300002449 | Bacteria | 10750 |
| 74 | JGI24698J34947_10008356 | 3300002449 | Unclassified | 5681 |
| 75 | JGI24698J34947_10029605 | 3300002449 | Unclassified | 2891 |
| 76 | JGI24702J35022_10058157 | 3300002462 | Bacteria | 2065 |
| 77 | Ga0072940_1028637 | 3300005200 | Bacteria | 17491 |
| 78 | Ga0466712_049284 | 3300042614 | Bacteria | 20516 |
| 79 | Ga0466712_111349 | 3300042614 | Bacteria | 22891 |
| 80 | Ga0466718_107011 | 3300042617 | Bacteria | 9972 |
| 81 | Ga0466726_097536 | 3300042619 | Bacteria | 2215 |
| 82 | Ga0466719_158823 | 3300042606 | Bacteria | 2204 |
| 83 | Ga0466702_070354 | 3300042635 | Bacteria | 3263 |
| 84 | Ga0466703_038818 | 3300042636 | Bacteria | 10654 |
| 85 | Ga0466727_124616 | 3300042655 | Bacteria | 3367 |
| 86 | Ga0466727_296160 | 3300042655 | Bacteria | 3849 |
| 87 | Ga0466692_180553 | 3300042591 | Bacteria | 13183 |
| 88 | Ga0466693_081613 | 3300042592 | Bacteria | 56251 |
| 89 | Ga0466691_086759 | 3300042593 | Bacteria | 2105 |
| 90 | Ga0466696_198532 | 3300042596 | Bacteria | 1912 |
| 91 | Ga0123356_10101016 | 3300010049 | Bacteria | 2767 |
| 92 | JGI24698J34947_10006777 | 3300002449 | Bacteria | 6292 |
| 93 | JGI24698J34947_10059740 | 3300002449 | Unclassified | 1883 |
| 94 | Ga0466712_068653 | 3300042614 | Bacteria | 16089 |
| 95 | Ga0466715_501402 | 3300042616 | Bacteria | 4201 |
| 96 | Ga0466718_047531 | 3300042617 | Bacteria | 24924 |
| 97 | Ga0466733_162255 | 3300042659 | Bacteria | 6092 |
| 98 | Ga0466713_022422 | 3300042602 | Bacteria | 15623 |
| 99 | Ga0466714_132215 | 3300042603 | Bacteria | 2287 |
| 100 | Ga0466719_060669 | 3300042606 | Bacteria | 11110 |
| 101 | Ga0466719_117265 | 3300042606 | Bacteria | 3465 |
| 102 | Ga0466722_166290 | 3300042609 | Bacteria | 2687 |
| 103 | Ga0466731_317745 | 3300042622 | Bacteria | 4329 |
| 104 | Ga0466731_355720 | 3300042622 | Unclassified | 1491 |
| 105 | Ga0466735_068434 | 3300042624 | Bacteria | 1867 |
| 106 | Ga0466703_156913 | 3300042636 | Bacteria | 17468 |
| 107 | Ga0466704_110726 | 3300042643 | Bacteria | 63753 |
| 108 | Ga0466704_211404 | 3300042643 | Bacteria | 8108 |
| 109 | Ga0466704_494586 | 3300042643 | Bacteria | 1844 |
| 110 | Ga0466709_345358 | 3300042648 | Bacteria | 4066 |
| 111 | Ga0264413_118239 | 3300024493 | Unclassified | 4460 |
| 112 | Ga0466690_022255 | 3300042590 | Bacteria | 5373 |
| 113 | Ga0466696_030721 | 3300042596 | Bacteria | 3605 |
| 114 | Ga0466699_169942 | 3300042597 | Bacteria | 10439 |
| 115 | Ga0123356_10617187 | 3300010049 | Bacteria | 1250 |
| 116 | JGI24698J34947_10000832 | 3300002449 | Bacteria | 15451 |
| 117 | JGI24698J34947_10013623 | 3300002449 | Bacteria | 4434 |
| 118 | JGI24698J34947_10052792 | 3300002449 | Bacteria | 2038 |
| 119 | Ga0068302_10025557 | 3300005071 | Bacteria | 2036 |
| 120 | Ga0072941_1006689 | 3300005201 | Bacteria | 11018 |
| 121 | Ga0072941_1008954 | 3300005201 | Bacteria | 20164 |
| 122 | Ga0466705_438604 | 3300042612 | Bacteria | 49382 |
| 123 | Ga0466712_166010 | 3300042614 | Bacteria | 6026 |
| 124 | Ga0466711_200323 | 3300042615 | Bacteria | 39261 |
| 125 | Ga0466718_131665 | 3300042617 | Bacteria | 16884 |
| 126 | Ga0466726_174287 | 3300042619 | Bacteria | 3963 |
| 127 | Ga0466732_236666 | 3300042656 | Bacteria | 1575 |
| 128 | Ga0466733_065487 | 3300042659 | Bacteria | 81466 |
| 129 | Ga0466707_324410 | 3300042601 | Bacteria | 1752 |
| 130 | Ga0466707_405565 | 3300042601 | Bacteria | 1133 |
| 131 | Ga0466716_362528 | 3300042605 | Bacteria | 5653 |
| 132 | Ga0466722_052590 | 3300042609 | Bacteria | 4955 |
| 133 | Ga0466731_364596 | 3300042622 | Bacteria | 3097 |
| 134 | Ga0466731_428404 | 3300042622 | Bacteria | 3380 |
| 135 | Ga0415639_025745 | 3300038395 | Bacteria | 33738 |
| 136 | Ga0466690_011197 | 3300042590 | Unclassified | 2121 |
| 137 | Ga0466690_372883 | 3300042590 | Bacteria | 4606 |
| 138 | Ga0466696_178775 | 3300042596 | Bacteria | 5221 |
| 139 | Ga0466696_244547 | 3300042596 | Bacteria | 6729 |
| 140 | Ga0123356_10012597 | 3300010049 | Bacteria | 8199 |
| 141 | Ga0123356_10221347 | 3300010049 | Bacteria | 1949 |
| 142 | JGI24698J34947_10000031 | 3300002449 | Bacteria | 38432 |
| 143 | JGI24698J34947_10032068 | 3300002449 | Unclassified | 2760 |
| 144 | Ga0072941_1000124 | 3300005201 | Bacteria | 11073 |
| 145 | Ga0466712_101304 | 3300042614 | Bacteria | 4478 |
| 146 | Ga0466712_268881 | 3300042614 | Bacteria | 14662 |
| 147 | Ga0466712_306692 | 3300042614 | Unclassified | 14047 |
| 148 | Ga0466712_316789 | 3300042614 | Bacteria | 83741 |
| 149 | Ga0466715_440491 | 3300042616 | Bacteria | 2974 |
| 150 | Ga0466726_294742 | 3300042619 | Bacteria | 2067 |
| 151 | Ga0466729_014768 | 3300042621 | Bacteria | 2121 |
| 152 | Ga0466705_254924 | 3300042612 | Bacteria | 3138 |
| 153 | Ga0466705_340019 | 3300042612 | Bacteria | 3166 |
| 154 | Ga0466713_065096 | 3300042602 | Bacteria | 2671 |
| 155 | Ga0466722_124660 | 3300042609 | Bacteria | 2786 |
| 156 | Ga0466708_198335 | 3300042652 | Bacteria | 35517 |
| 157 | Ga0415639_015002 | 3300038395 | Bacteria | 8627 |
| 158 | Ga0415639_025242 | 3300038395 | Bacteria | 4364 |
| 159 | Ga0466690_432608 | 3300042590 | Unclassified | 5075 |
| 160 | Ga0466694_050111 | 3300042594 | Bacteria | 44560 |
| 161 | Ga0123356_10059012 | 3300010049 | Bacteria | 3579 |
| 162 | AustNasuHG_c1006839 | 3300000089 | Unclassified | 4062 |
| 163 | AustNasuHG_c1011571 | 3300000089 | Bacteria | 3056 |
| 164 | JGI24702J35022_10029844 | 3300002462 | Bacteria | 2925 |
| 165 | Ga0072941_1024851 | 3300005201 | Bacteria | 6617 |
| 166 | Ga0466718_061380 | 3300042617 | Bacteria | 1634 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01515 | PTA_PTB | Phosphate acetyl/butaryl transferase | 56 | 378 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01515 | GO:0016746 | acyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.