Protein Family IF05138

Metagenome Isolate
143 Members
69 Samples
120 Scaffolds
333.82 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_104973|Ga0466696_104973_1537_2739
Length
400 aa
Sequence
MNDFYIVAKKYSSKNFDENNCGENFAWLFRMTRSFLLRHYKICLFLFSTYFSHTFNEVFNLQHLSTMTATIYYDKDADLSQLKGKTIAILGYGSQGHAHAQNLRDSGCEVIVAEVKGTHNYELAVQDKFKPLTTEEAVKRADLIVLTLPDELQANIFETQIRPNLSEGNLIIATHGFNVHYGQFNMPKGVYAILIAPKGPGHLVRSEFTKGGGVPCLIALGEGAGDKERKIGLAYAKGIGGTRGGVIETTFAEETETDLFGEQVVLCGGVSALVQKAFEVLVEAGYQPEMAYFECMHELKLIVDLFYQGGLNYMRYSVSNTAEFGDYTRGSRIITDETKTEMKKILTEIQTGEFAKEWLLENKVGAPKFKRIRAIQRQHQLEEVGRRLRKLMSWIDAKEF

📊 Sample Types

Isolate 16.1%
Metagenome 83.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Unclassified 30.4%
Kalotermitidae 18.8%
Tenebrionidae 5.8%
Rhinotermitidae 4.3%
Termopsidae 2.9%
Blattidae 2.9%
Culicidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
12 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
13 2820110010 Unclassified Proteobacteria Emb289P4bin35 Isolate Unclassified
14 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
15 2820189034 Unclassified Planctomycetes Emb289P4bin17 Isolate Unclassified
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
22 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
23 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
24 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
31 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
32 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
35 2820918931 Unclassified Actinobacteria Emb289P3bin56 Isolate Unclassified
36 2820044805 Unclassified Proteobacteria Th196P4bin15 Isolate Unclassified
37 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
40 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
41 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
42 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
43 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
47 2820068815 Unclassified Proteobacteria Nt197P3bin4 Isolate Unclassified
48 2820193510 Unclassified Planctomycetes Emb289P3bin83 Isolate Unclassified
49 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
50 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
51 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
52 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
53 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
54 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
55 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
56 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
57 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
58 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
59 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
60 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
61 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
62 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
63 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
64 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
65 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
66 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
67 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
68 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
69 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_117323 3300042612 Bacteria 23353
2 Ga0466733_191977 3300042659 Bacteria 4776
3 Ga0466711_151663 3300042615 Unclassified 6178
4 Ga0466711_167319 3300042615 Bacteria 5804
5 Ga0466723_096474 3300042618 Bacteria 2180
6 Ga0466726_293994 3300042619 Bacteria 20611
7 Ga0466728_319542 3300042620 Bacteria 12559
8 Ga0466728_340153 3300042620 Unclassified 1811
9 Ga0466731_169964 3300042622 Unclassified 1710
10 Ga0466724_59189 3300042649 Bacteria 1212
11 Ga0466727_000584 3300042655 Bacteria 3357
12 Ga0123356_10066201 3300010049 Bacteria 3382
13 Ga0123353_10029185 3300010167 Bacteria 8495
14 Ga0123357_10000691 3300009784 Bacteria 33780
15 Ga0466705_317371 3300042612 Bacteria 146251
16 Ga0466716_250653 3300042605 Unclassified 17921
17 Ga0466719_306626 3300042606 Bacteria 7564
18 Ga0466720_213910 3300042607 Bacteria 1488
19 Ga0466715_011393 3300042616 Bacteria 13850
20 Ga0466715_244350 3300042616 Unclassified 12691
21 Ga0466715_394986 3300042616 Bacteria 4179
22 Ga0466723_108119 3300042618 Bacteria 2291
23 Ga0466728_092277 3300042620 Bacteria 3183
24 Ga0466734_140169 3300042623 Bacteria 2493
25 Ga0466704_370101 3300042643 Unclassified 2704
26 Ga0466708_254310 3300042652 Bacteria 21277
27 Ga0466691_145825 3300042593 Bacteria 6874
28 Ga0466695_089315 3300042595 Bacteria 3236
29 Ga0466695_234822 3300042595 Bacteria 1823
30 Ga0466705_008734 3300042612 Bacteria 11580
31 Ga0466705_326958 3300042612 Unclassified 7949
32 Ga0466711_042008 3300042615 Bacteria 7110
33 Ga0466711_192975 3300042615 Bacteria 7828
34 Ga0466715_461929 3300042616 Bacteria 5509
35 Ga0466723_245669 3300042618 Bacteria 17901
36 Ga0466726_198510 3300042619 Bacteria 11133
37 Ga0466729_204055 3300042621 Bacteria 4711
38 Ga0466704_596816 3300042643 Bacteria 34729
39 Ga0123353_10002645 3300010167 Bacteria 22293
40 Ga0466695_130112 3300042595 Bacteria 1786
41 JGI24702J35022_10008743 3300002462 Bacteria 5715
42 JGI24702J35022_10019152 3300002462 Unclassified 3725
43 Ga0466732_008246 3300042656 Bacteria 2412
44 Ga0466698_440801 3300042610 Bacteria 1562
45 Ga0466715_534893 3300042616 Bacteria 57298
46 Ga0466703_077650 3300042636 Bacteria 5648
47 Ga0466704_470314 3300042643 Bacteria 3089
48 Ga0466708_445113 3300042652 Bacteria 15046
49 Ga0466725_439589 3300042654 Bacteria 1096
50 Ga0123353_10000676 3300010167 Bacteria 41652
51 Ga0466705_065028 3300042612 Bacteria 59479
52 Ga0562376_1213 3300056857 Bacteria 37525
53 Ga0466700_361546 3300042600 Bacteria 1488
54 Ga0466717_289125 3300042604 Bacteria 4243
55 Ga0466698_242059 3300042610 Bacteria 9355
56 Ga0466718_139942 3300042617 Bacteria 2932
57 Ga0466703_178509 3300042636 Bacteria 4792
58 Ga0466704_412297 3300042643 Bacteria 21026
59 Ga0123355_10062490 3300009826 Bacteria 6010
60 Ga0123353_10001298 3300010167 Bacteria 30644
61 Ga0123353_10244064 3300010167 Bacteria 2788
62 Ga0466692_070264 3300042591 Bacteria 8232
63 Ga0466693_196591 3300042592 Bacteria 1118
64 Ga0562377_0071 3300056842 Bacteria 439264
65 Ga0466716_182395 3300042605 Bacteria 1608
66 Ga0466711_279926 3300042615 Bacteria 5252
67 Ga0466723_075017 3300042618 Bacteria 7830
68 Ga0466729_028638 3300042621 Bacteria 4330
69 Ga0466729_284764 3300042621 Unclassified 3309
70 Ga0466703_237278 3300042636 Bacteria 6250
71 Ga0466703_427775 3300042636 Bacteria 5767
72 Ga0466727_022509 3300042655 Bacteria 6089
73 Ga0123355_10615969 3300009826 Bacteria 1282
74 Ga0123353_10011371 3300010167 Bacteria 12534
75 Ga0160435_1005080 3300012857 Bacteria 3009
76 Ga0466690_185439 3300042590 Bacteria 2176
77 Ga0466696_104973 3300042596 Bacteria 4919
78 Ga0466699_152121 3300042597 Bacteria 2566
79 Ga0466699_367546 3300042597 Unclassified 1596
80 Ga0466705_126207 3300042612 Bacteria 16830
81 Ga0466733_135895 3300042659 Bacteria 10236
82 Ga0562375_1591 3300056856 Unclassified 29702
83 Ga0466716_356899 3300042605 Bacteria 1491
84 Ga0466716_506437 3300042605 Bacteria 10970
85 Ga0466715_015911 3300042616 Bacteria 29550
86 Ga0466715_049262 3300042616 Bacteria 18729
87 Ga0466715_154491 3300042616 Bacteria 1757
88 Ga0466723_172984 3300042618 Bacteria 5898
89 Ga0466729_080038 3300042621 Bacteria 4482
90 Ga0466703_199351 3300042636 Unclassified 2312
91 Ga0466704_058830 3300042643 Bacteria 7462
92 Ga0466704_214644 3300042643 Bacteria 2526
93 Ga0466704_273138 3300042643 Bacteria 1623
94 Ga0466704_522542 3300042643 Bacteria 4608
95 Ga0466708_250905 3300042652 Bacteria 9024
96 Ga0123355_10015304 3300009826 Bacteria 12045
97 Ga0466690_198399 3300042590 Bacteria 1614
98 Ga0466690_372317 3300042590 Unclassified 9884
99 Ga0466696_489378 3300042596 Unclassified 2722
100 Ga0466699_037930 3300042597 Bacteria 1975
101 JGI24702J35022_10018400 3300002462 Bacteria 3810
102 Ga0466705_027419 3300042612 Bacteria 37190
103 Ga0466733_208883 3300042659 Bacteria 1480
104 Ga0530661_002401 3300056564 Bacteria 7115
105 Ga0466700_017374 3300042600 Bacteria 2432
106 Ga0466707_123132 3300042601 Bacteria 19417
107 Ga0466719_204773 3300042606 Bacteria 11115
108 Ga0466715_270412 3300042616 Bacteria 17234
109 Ga0466723_104235 3300042618 Unclassified 1613
110 Ga0466702_194490 3300042635 Bacteria 1337
111 Ga0466704_100934 3300042643 Unclassified 12931
112 Ga0466708_017782 3300042652 Bacteria 33054
113 Ga0123355_10000365 3300009826 Bacteria 58534
114 Ga0123356_10147226 3300010049 Unclassified 2332
115 Ga0123353_10005063 3300010167 Bacteria 17199
116 Ga0123353_10490788 3300010167 Unclassified 1793
117 Ga0123354_10147382 3300010882 Unclassified 2873
118 Ga0466691_017755 3300042593 Bacteria 6431
119 JGI24698J34947_10009370 3300002449 Bacteria 5376
120 JGI24695J34938_10034023 3300002450 Bacteria 2340

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain 251 394 1
PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain 82 245 0.99
PF00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain 82 147 0.9
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 74 150 0.85
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 86 172 0.84
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 86 174 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02826 GO:0051287 NAD binding MF
PF03446 GO:0050661 NADP binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.