Protein Family IF05124
Metagenome
Isolate
133
Members
38
Samples
131
Scaffolds
281.11
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_072700|Ga0466696_072700_3069_3995
- Length
- 308 aa
- Sequence
- MELDWFHRFGYIYDLIRPVLDIGILAFLLYKVYVFLVKTQAMQLVRGAGFLTLVYGVAYLFRLTTLQWILQTLGPGFFVVIAIVFQPELRKIIMRLGQGDIFRPDTKPRIGKLDAVITAAEILSQERRGALVVFSRKTNIRNIIDTGTRMNAEISSPLIVAVFEFDGPLHDGAMVIQNGHIAAAGCFLPLSDQQGIRKSFGTRHRAALGMSEQSDAVILVVSEETGALSLAFDSKIYYDLSTLEITRRLKELLDRGARRESFDASPKELGGGFGSAAESSLGLDLGPNLGAGSGELAPKENADVFAKP
Sample Types
Isolate
1.5%
Metagenome
98.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.5%
Kalotermitidae
35.1%
Rhinotermitidae
10.8%
Termopsidae
8.1%
Unclassified
5.4%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_008883 | 3300042612 | Bacteria | 10527 |
| 2 | Ga0466732_247089 | 3300042656 | Bacteria | 1441 |
| 3 | Ga0466733_126520 | 3300042659 | Bacteria | 3760 |
| 4 | Ga0466720_057406 | 3300042607 | Bacteria | 28295 |
| 5 | Ga0466720_061312 | 3300042607 | Bacteria | 6337 |
| 6 | Ga0466720_089466 | 3300042607 | Bacteria | 2505 |
| 7 | Ga0466722_006183 | 3300042609 | Bacteria | 4754 |
| 8 | Ga0123353_10004792 | 3300010167 | Bacteria | 17557 |
| 9 | Ga0466703_225853 | 3300042636 | Bacteria | 41639 |
| 10 | Ga0466703_432496 | 3300042636 | Bacteria | 1591 |
| 11 | Ga0466704_543236 | 3300042643 | Bacteria | 6827 |
| 12 | Ga0466712_078296 | 3300042614 | Bacteria | 3013 |
| 13 | Ga0466712_108423 | 3300042614 | Bacteria | 28842 |
| 14 | Ga0466718_149161 | 3300042617 | Bacteria | 41124 |
| 15 | Ga0466718_170241 | 3300042617 | Bacteria | 2090 |
| 16 | Ga0466696_072700 | 3300042596 | Bacteria | 8396 |
| 17 | Ga0466699_066651 | 3300042597 | Bacteria | 26757 |
| 18 | Ga0466699_099040 | 3300042597 | Bacteria | 17566 |
| 19 | Ga0466699_414818 | 3300042597 | Bacteria | 3565 |
| 20 | Ga0466700_130170 | 3300042600 | Bacteria | 3908 |
| 21 | Ga0466719_137056 | 3300042606 | Bacteria | 1596 |
| 22 | Ga0466719_232452 | 3300042606 | Bacteria | 4917 |
| 23 | Ga0466720_218357 | 3300042607 | Bacteria | 7469 |
| 24 | Ga0466703_382005 | 3300042636 | Bacteria | 2569 |
| 25 | Ga0466704_241534 | 3300042643 | Bacteria | 11549 |
| 26 | Ga0466705_488971 | 3300042612 | Bacteria | 7617 |
| 27 | Ga0466712_099229 | 3300042614 | Bacteria | 9523 |
| 28 | Ga0466712_141549 | 3300042614 | Bacteria | 3222 |
| 29 | AustNasuHG_c1006967 | 3300000089 | Bacteria | 4028 |
| 30 | Ga0456237_0000845 | 3300041968 | Bacteria | 4786 |
| 31 | Ga0466694_163503 | 3300042594 | Bacteria | 2884 |
| 32 | Ga0466705_341651 | 3300042612 | Bacteria | 3521 |
| 33 | Ga0466719_372415 | 3300042606 | Bacteria | 2616 |
| 34 | Ga0466720_057596 | 3300042607 | Unclassified | 4977 |
| 35 | Ga0466704_165993 | 3300042643 | Bacteria | 7747 |
| 36 | Ga0466708_042419 | 3300042652 | Bacteria | 5537 |
| 37 | Ga0466708_332499 | 3300042652 | Bacteria | 7707 |
| 38 | Ga0466715_338580 | 3300042616 | Bacteria | 2825 |
| 39 | Ga0466723_160902 | 3300042618 | Bacteria | 23441 |
| 40 | Ga0466726_447854 | 3300042619 | Bacteria | 1465 |
| 41 | Ga0466728_066559 | 3300042620 | Bacteria | 1084 |
| 42 | JGI24698J34947_10079560 | 3300002449 | Bacteria | 1543 |
| 43 | Ga0072941_1027778 | 3300005201 | Bacteria | 16466 |
| 44 | Ga0072941_1151609 | 3300005201 | Bacteria | 4091 |
| 45 | Ga0466692_077354 | 3300042591 | Bacteria | 1849 |
| 46 | Ga0466705_082305 | 3300042612 | Bacteria | 4805 |
| 47 | Ga0466735_074452 | 3300042624 | Bacteria | 1509 |
| 48 | Ga0466708_340454 | 3300042652 | Bacteria | 22551 |
| 49 | Ga0466712_243949 | 3300042614 | Bacteria | 1309 |
| 50 | Ga0466711_166346 | 3300042615 | Bacteria | 23077 |
| 51 | Ga0466726_329591 | 3300042619 | Bacteria | 2803 |
| 52 | Ga0466729_188114 | 3300042621 | Bacteria | 8970 |
| 53 | Ga0466690_292396 | 3300042590 | Bacteria | 9728 |
| 54 | Ga0466692_041598 | 3300042591 | Bacteria | 6571 |
| 55 | Ga0466692_074749 | 3300042591 | Bacteria | 8076 |
| 56 | Ga0466696_396821 | 3300042596 | Bacteria | 23354 |
| 57 | Ga0466699_272410 | 3300042597 | Bacteria | 2706 |
| 58 | Ga0466732_301267 | 3300042656 | Bacteria | 18035 |
| 59 | Ga0466720_035328 | 3300042607 | Bacteria | 9131 |
| 60 | Ga0466722_045346 | 3300042609 | Bacteria | 1098 |
| 61 | Ga0466722_183537 | 3300042609 | Bacteria | 7480 |
| 62 | Ga0466703_157175 | 3300042636 | Bacteria | 8256 |
| 63 | Ga0466703_239750 | 3300042636 | Unclassified | 11228 |
| 64 | Ga0466704_178707 | 3300042643 | Bacteria | 12826 |
| 65 | Ga0466704_219441 | 3300042643 | Bacteria | 6438 |
| 66 | Ga0466708_071970 | 3300042652 | Bacteria | 22670 |
| 67 | Ga0466715_036933 | 3300042616 | Bacteria | 7782 |
| 68 | Ga0466715_250478 | 3300042616 | Bacteria | 13481 |
| 69 | Ga0466723_061161 | 3300042618 | Bacteria | 56205 |
| 70 | JGI24698J34947_10005078 | 3300002449 | Bacteria | 7207 |
| 71 | Ga0466694_193230 | 3300042594 | Bacteria | 22493 |
| 72 | Ga0466696_125586 | 3300042596 | Bacteria | 5690 |
| 73 | Ga0466699_081795 | 3300042597 | Bacteria | 1164 |
| 74 | Ga0466705_238021 | 3300042612 | Bacteria | 1957 |
| 75 | Ga0466720_111891 | 3300042607 | Bacteria | 23574 |
| 76 | Ga0466722_033995 | 3300042609 | Bacteria | 3509 |
| 77 | Ga0466722_082430 | 3300042609 | Bacteria | 14177 |
| 78 | Ga0123353_10078838 | 3300010167 | Bacteria | 5295 |
| 79 | Ga0466735_006506 | 3300042624 | Bacteria | 6913 |
| 80 | Ga0466703_147752 | 3300042636 | Bacteria | 42366 |
| 81 | Ga0466704_142482 | 3300042643 | Bacteria | 18454 |
| 82 | Ga0466704_166192 | 3300042643 | Bacteria | 5275 |
| 83 | Ga0466704_249234 | 3300042643 | Bacteria | 26787 |
| 84 | Ga0466709_159788 | 3300042648 | Bacteria | 6778 |
| 85 | Ga0466712_106734 | 3300042614 | Bacteria | 18708 |
| 86 | Ga0466712_133281 | 3300042614 | Bacteria | 11397 |
| 87 | JGI24695J34938_10041803 | 3300002450 | Bacteria | 2056 |
| 88 | Ga0072941_1001887 | 3300005201 | Bacteria | 25060 |
| 89 | Ga0072941_1055446 | 3300005201 | Bacteria | 11027 |
| 90 | Ga0072941_1129866 | 3300005201 | Bacteria | 4522 |
| 91 | Ga0466690_171936 | 3300042590 | Bacteria | 20676 |
| 92 | Ga0466691_081910 | 3300042593 | Bacteria | 24279 |
| 93 | Ga0466699_044144 | 3300042597 | Bacteria | 8466 |
| 94 | Ga0466699_062500 | 3300042597 | Bacteria | 15424 |
| 95 | Ga0466699_254844 | 3300042597 | Bacteria | 4988 |
| 96 | Ga0466705_011421 | 3300042612 | Bacteria | 6664 |
| 97 | Ga0466719_139842 | 3300042606 | Bacteria | 32913 |
| 98 | Ga0466720_013491 | 3300042607 | Bacteria | 1644 |
| 99 | Ga0123353_10192062 | 3300010167 | Bacteria | 3222 |
| 100 | Ga0466730_028059 | 3300042625 | Bacteria | 1007 |
| 101 | Ga0466703_055126 | 3300042636 | Bacteria | 11926 |
| 102 | Ga0466708_032429 | 3300042652 | Bacteria | 3651 |
| 103 | Ga0466718_004166 | 3300042617 | Unclassified | 1007 |
| 104 | Ga0466718_084149 | 3300042617 | Bacteria | 9125 |
| 105 | Ga0466723_206226 | 3300042618 | Bacteria | 4965 |
| 106 | Ga0466723_220766 | 3300042618 | Bacteria | 8541 |
| 107 | Ga0466728_038230 | 3300042620 | Bacteria | 12914 |
| 108 | JGI24698J34947_10009064 | 3300002449 | Bacteria | 5459 |
| 109 | JGI24698J34947_10077609 | 3300002449 | Unclassified | 1570 |
| 110 | Ga0415639_126787 | 3300038395 | Bacteria | 1163 |
| 111 | Ga0466692_191565 | 3300042591 | Bacteria | 23772 |
| 112 | Ga0466691_046915 | 3300042593 | Bacteria | 6723 |
| 113 | Ga0466699_002512 | 3300042597 | Bacteria | 4499 |
| 114 | Ga0466705_192192 | 3300042612 | Bacteria | 15227 |
| 115 | Ga0466719_403668 | 3300042606 | Bacteria | 8615 |
| 116 | Ga0466720_054711 | 3300042607 | Bacteria | 8605 |
| 117 | Ga0466722_012340 | 3300042609 | Bacteria | 7442 |
| 118 | Ga0123356_10001609 | 3300010049 | Bacteria | 24816 |
| 119 | Ga0466704_073478 | 3300042643 | Bacteria | 2162 |
| 120 | Ga0466709_233000 | 3300042648 | Bacteria | 8436 |
| 121 | Ga0466708_312919 | 3300042652 | Bacteria | 38616 |
| 122 | Ga0466727_000110 | 3300042655 | Bacteria | 11699 |
| 123 | Ga0466727_345753 | 3300042655 | Bacteria | 2232 |
| 124 | Ga0466712_252963 | 3300042614 | Bacteria | 13653 |
| 125 | Ga0466711_474756 | 3300042615 | Bacteria | 2122 |
| 126 | Ga0466723_300651 | 3300042618 | Bacteria | 6057 |
| 127 | Ga0466726_314554 | 3300042619 | Bacteria | 8912 |
| 128 | Ga0466728_299378 | 3300042620 | Bacteria | 5528 |
| 129 | JGI24698J34947_10095737 | 3300002449 | Bacteria | 1349 |
| 130 | Ga0415639_113158 | 3300038395 | Bacteria | 6369 |
| 131 | Ga0466699_241295 | 3300042597 | Bacteria | 39977 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02457 | DAC | DisA bacterial checkpoint controller nucleotide-binding | 118 | 235 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.