Protein Family IF05116
Metagenome
Isolate
136
Members
46
Samples
135
Scaffolds
328.68
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_063986|Ga0466696_063986_2755_3879
- Length
- 374 aa
- Sequence
- MPKTLSYRGGSVIYFQGDVADKICVVQKGSVRVTYQDIETGNDEHETLQPGEFFGVKSALGRYNREEDAVALQNSEIMTLSVGEFERFAMANTRIIVKMLKVFSNQLRRIHRQVTSLMVKEEQPGPEAGLFNVGEYYLKNRRYVQARYVFSRYLTYYPAGDKASEATKGLEIAESVLSEEESGVQVAALPSSGTGFIVGAGGSFALGTAGFASRPNGPQATPDGKSTGSVGNPLRSGKASAVPAVSKQIDVPKAYSVAASLIARKQYRQAYTALREIIESGSDKEYIVKSDFDIGRCLFMMEKFNDCIQHLSRVISNYPKHPELGTALFLMGRSYEKIGYKDQAAVFYKKILSVVTGEEGIGAEAKQALKELEA
Sample Types
Isolate
0.7%
Metagenome
99.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
31.8%
Termopsidae
6.8%
Unclassified
6.8%
Rhinotermitidae
4.5%
Taxonomy
Archaea
2
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 18 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 19 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 20 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 21 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 44 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_427024 | 3300042656 | Bacteria | 5334 |
| 2 | Ga0466711_064978 | 3300042615 | Bacteria | 2523 |
| 3 | Ga0415639_034538 | 3300038395 | Bacteria | 7555 |
| 4 | Ga0466690_322180 | 3300042590 | Bacteria | 26244 |
| 5 | Ga0466691_158179 | 3300042593 | Bacteria | 9823 |
| 6 | Ga0466694_319170 | 3300042594 | Bacteria | 18383 |
| 7 | Ga0466696_063986 | 3300042596 | Bacteria | 4365 |
| 8 | Ga0466703_191099 | 3300042636 | Bacteria | 5399 |
| 9 | Ga0466707_366271 | 3300042601 | Bacteria | 1735 |
| 10 | Ga0466698_268134 | 3300042610 | Bacteria | 2383 |
| 11 | Ga0123356_10051217 | 3300010049 | Bacteria | 3841 |
| 12 | Ga0123354_10137665 | 3300010882 | Bacteria | 3042 |
| 13 | AustNasuHG_c1000357 | 3300000089 | Bacteria | 15851 |
| 14 | AustNasuHG_c1003106 | 3300000089 | Bacteria | 5991 |
| 15 | JGI24698J34947_10004113 | 3300002449 | Bacteria | 7893 |
| 16 | JGI24698J34947_10004992 | 3300002449 | Bacteria | 7271 |
| 17 | JGI24695J34938_10022763 | 3300002450 | Bacteria | 3034 |
| 18 | Ga0466712_090234 | 3300042614 | Bacteria | 7801 |
| 19 | Ga0466718_018877 | 3300042617 | Bacteria | 3965 |
| 20 | Ga0466718_019624 | 3300042617 | Bacteria | 5790 |
| 21 | Ga0466699_193982 | 3300042597 | Bacteria | 2276 |
| 22 | Ga0466735_105880 | 3300042624 | Bacteria | 2790 |
| 23 | Ga0466702_172769 | 3300042635 | Bacteria | 6596 |
| 24 | Ga0466704_003182 | 3300042643 | Bacteria | 1326 |
| 25 | Ga0466708_307922 | 3300042652 | Bacteria | 14416 |
| 26 | Ga0466716_072177 | 3300042605 | Bacteria | 14821 |
| 27 | Ga0466716_094974 | 3300042605 | Bacteria | 17045 |
| 28 | Ga0466720_110783 | 3300042607 | Bacteria | 12469 |
| 29 | Ga0466722_003624 | 3300042609 | Bacteria | 6344 |
| 30 | Ga0466722_064257 | 3300042609 | Bacteria | 17947 |
| 31 | Ga0466698_170034 | 3300042610 | Bacteria | 1884 |
| 32 | Ga0123356_10000619 | 3300010049 | Bacteria | 39296 |
| 33 | Ga0123353_10250608 | 3300010167 | Bacteria | 2743 |
| 34 | AustNasuHG_c1004489 | 3300000089 | Bacteria | 5004 |
| 35 | JGI24695J34938_10000054 | 3300002450 | Bacteria | 90526 |
| 36 | JGI24699J35502_11127233 | 3300002509 | Bacteria | 4112 |
| 37 | Ga0466705_255173 | 3300042612 | Bacteria | 9871 |
| 38 | Ga0466712_067146 | 3300042614 | Bacteria | 17771 |
| 39 | Ga0466712_134363 | 3300042614 | Bacteria | 9488 |
| 40 | Ga0466715_385690 | 3300042616 | Bacteria | 3169 |
| 41 | Ga0466696_273150 | 3300042596 | Bacteria | 1116 |
| 42 | Ga0466696_301864 | 3300042596 | Bacteria | 2868 |
| 43 | Ga0466704_234201 | 3300042643 | Bacteria | 5218 |
| 44 | Ga0466704_301099 | 3300042643 | Bacteria | 16023 |
| 45 | Ga0466700_147707 | 3300042600 | Bacteria | 1268 |
| 46 | Ga0466719_484518 | 3300042606 | Bacteria | 1507 |
| 47 | Ga0466722_212944 | 3300042609 | Bacteria | 4941 |
| 48 | JGI24698J34947_10003142 | 3300002449 | Bacteria | 8946 |
| 49 | JGI24695J34938_10007268 | 3300002450 | Bacteria | 6522 |
| 50 | Ga0072940_1135864 | 3300005200 | Bacteria | 1544 |
| 51 | Ga0466705_019373 | 3300042612 | Bacteria | 7107 |
| 52 | Ga0466705_107954 | 3300042612 | Bacteria | 3458 |
| 53 | Ga0466711_094699 | 3300042615 | Bacteria | 8883 |
| 54 | Ga0466718_094102 | 3300042617 | Bacteria | 2669 |
| 55 | Ga0466723_279391 | 3300042618 | Bacteria | 3866 |
| 56 | Ga0466726_285182 | 3300042619 | Bacteria | 2488 |
| 57 | Ga0466694_091184 | 3300042594 | Bacteria | 7807 |
| 58 | Ga0466694_341290 | 3300042594 | Bacteria | 1745 |
| 59 | Ga0466694_369154 | 3300042594 | Bacteria | 2497 |
| 60 | Ga0466696_029581 | 3300042596 | Bacteria | 14800 |
| 61 | Ga0466703_022881 | 3300042636 | Bacteria | 15863 |
| 62 | Ga0466708_005588 | 3300042652 | Bacteria | 17842 |
| 63 | Ga0466719_173306 | 3300042606 | Bacteria | 10733 |
| 64 | Ga0466719_290411 | 3300042606 | Bacteria | 2224 |
| 65 | Ga0466719_498429 | 3300042606 | Bacteria | 2493 |
| 66 | Ga0466722_121518 | 3300042609 | Bacteria | 3903 |
| 67 | Ga0123353_10514401 | 3300010167 | Bacteria | 1739 |
| 68 | AustNasuHG_c1000593 | 3300000089 | Bacteria | 12790 |
| 69 | AustNasuHG_c1006043 | 3300000089 | Bacteria | 4324 |
| 70 | JGI24698J34947_10000948 | 3300002449 | Bacteria | 14766 |
| 71 | JGI24695J34938_10001809 | 3300002450 | Bacteria | 17535 |
| 72 | Ga0074263_102292 | 3300005485 | Bacteria | 2178 |
| 73 | Ga0466711_427209 | 3300042615 | Bacteria | 10533 |
| 74 | Ga0466711_506971 | 3300042615 | Bacteria | 3926 |
| 75 | Ga0466715_111557 | 3300042616 | Bacteria | 2728 |
| 76 | Ga0466723_016280 | 3300042618 | Bacteria | 23329 |
| 77 | Ga0466690_390994 | 3300042590 | Bacteria | 6744 |
| 78 | Ga0466693_039002 | 3300042592 | Bacteria | 4163 |
| 79 | Ga0466703_000070 | 3300042636 | Bacteria | 1616 |
| 80 | Ga0466727_137603 | 3300042655 | Unclassified | 1109 |
| 81 | Ga0466716_310978 | 3300042605 | Bacteria | 3319 |
| 82 | Ga0466719_289212 | 3300042606 | Bacteria | 2152 |
| 83 | JGI24698J34947_10017484 | 3300002449 | Archaea | 3885 |
| 84 | Ga0072940_1014418 | 3300005200 | Bacteria | 17599 |
| 85 | Ga0466705_033841 | 3300042612 | Bacteria | 6126 |
| 86 | Ga0466705_293436 | 3300042612 | Bacteria | 17863 |
| 87 | Ga0466728_178467 | 3300042620 | Bacteria | 1803 |
| 88 | Ga0466696_175499 | 3300042596 | Bacteria | 15323 |
| 89 | Ga0466735_093542 | 3300042624 | Unclassified | 3204 |
| 90 | Ga0466704_382198 | 3300042643 | Unclassified | 3316 |
| 91 | Ga0466708_362559 | 3300042652 | Bacteria | 40015 |
| 92 | Ga0466727_138244 | 3300042655 | Bacteria | 1200 |
| 93 | Ga0123357_10115731 | 3300009784 | Bacteria | 3398 |
| 94 | Ga0123353_10110041 | 3300010167 | Bacteria | 4439 |
| 95 | JGI24695J34938_10000188 | 3300002450 | Bacteria | 57980 |
| 96 | JGI24695J34938_10014628 | 3300002450 | Bacteria | 4059 |
| 97 | Ga0072940_1103747 | 3300005200 | Bacteria | 2939 |
| 98 | Ga0072941_1095277 | 3300005201 | Bacteria | 2680 |
| 99 | Ga0072941_1124764 | 3300005201 | Bacteria | 1840 |
| 100 | Ga0466705_354808 | 3300042612 | Bacteria | 9154 |
| 101 | Ga0466718_042441 | 3300042617 | Bacteria | 8555 |
| 102 | Ga0466718_081429 | 3300042617 | Bacteria | 3913 |
| 103 | Ga0466728_030019 | 3300042620 | Bacteria | 50626 |
| 104 | Ga0264413_111745 | 3300024493 | Bacteria | 49890 |
| 105 | Ga0415639_089473 | 3300038395 | Bacteria | 3598 |
| 106 | Ga0466731_085284 | 3300042622 | Bacteria | 9469 |
| 107 | Ga0466703_267670 | 3300042636 | Bacteria | 3916 |
| 108 | Ga0466704_393806 | 3300042643 | Bacteria | 32177 |
| 109 | Ga0466720_083090 | 3300042607 | Bacteria | 3540 |
| 110 | Ga0466720_234456 | 3300042607 | Bacteria | 15202 |
| 111 | JGI24698J34947_10000667 | 3300002449 | Bacteria | 16665 |
| 112 | JGI24698J34947_10015775 | 3300002449 | Bacteria | 4109 |
| 113 | JGI24695J34938_10003611 | 3300002450 | Bacteria | 10630 |
| 114 | Ga0466705_259077 | 3300042612 | Bacteria | 12486 |
| 115 | Ga0466712_042932 | 3300042614 | Bacteria | 11222 |
| 116 | Ga0466715_514480 | 3300042616 | Bacteria | 23319 |
| 117 | Ga0466723_324427 | 3300042618 | Bacteria | 4585 |
| 118 | Ga0466726_455156 | 3300042619 | Bacteria | 3701 |
| 119 | Ga0466728_226073 | 3300042620 | Bacteria | 13706 |
| 120 | Ga0466692_125586 | 3300042591 | Bacteria | 17367 |
| 121 | Ga0466691_155349 | 3300042593 | Bacteria | 5986 |
| 122 | Ga0466694_020957 | 3300042594 | Bacteria | 2779 |
| 123 | Ga0466696_167687 | 3300042596 | Bacteria | 24593 |
| 124 | Ga0466702_292598 | 3300042635 | Bacteria | 3138 |
| 125 | Ga0466704_045441 | 3300042643 | Bacteria | 19579 |
| 126 | Ga0466709_280600 | 3300042648 | Bacteria | 8545 |
| 127 | Ga0466708_307101 | 3300042652 | Bacteria | 3662 |
| 128 | Ga0466713_064558 | 3300042602 | Bacteria | 6443 |
| 129 | Ga0466719_062280 | 3300042606 | Unclassified | 4944 |
| 130 | Ga0466719_083942 | 3300042606 | Bacteria | 5276 |
| 131 | Ga0466720_050842 | 3300042607 | Bacteria | 6713 |
| 132 | Ga0466722_072637 | 3300042609 | Bacteria | 8065 |
| 133 | Ga0123356_10076067 | 3300010049 | Bacteria | 3163 |
| 134 | JGI24698J34947_10005594 | 3300002449 | Bacteria | 6895 |
| 135 | JGI24698J34947_10021884 | 3300002449 | Archaea | 3434 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.