Protein Family IF05087
Metagenome
Isolate
114
Members
35
Samples
104
Scaffolds
176.66
Avg Length
Representative Sequence
- ID
- 3300042595|Ga0466695_377359|Ga0466695_377359_25023_25658
- Length
- 211 aa
- Sequence
- LPAGRRQVSAGELLFQELSKANPHLHAIYRVIKSFLWRKNMADKLTSIQNMIHEIRGQKVMFDSDLAALYQVETKYLNRTIKRNLQRFPTDFMFQLTEKEFSDLRCQIGTSSWGGSRYLPYVFTEQGIAMLSGLLNSEIAIKVNIQIMRTFVQLRHYAFTKSDTNEQITELRKLLLLYIEKNDKRANDIIIALNNLIAQPKPTKRIGFKAD
Sample Types
Isolate
7.0%
Metagenome
93.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
70.6%
Unclassified
29.4%
Taxonomy
Archaea
1
Bacteria
98
Eukaryota
0
Viruses
1
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 3 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 4 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 5 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 6 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 7 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 8 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 24 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 32 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 33 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 34 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 35 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_136829 | 3300042656 | Bacteria | 1153 |
| 2 | Ga0466712_053750 | 3300042614 | Bacteria | 14360 |
| 3 | Ga0466718_029799 | 3300042617 | Bacteria | 2686 |
| 4 | Ga0123356_10000840 | 3300010049 | Bacteria | 34118 |
| 5 | Ga0123356_10316257 | 3300010049 | Bacteria | 1672 |
| 6 | Ga0123356_10481178 | 3300010049 | Bacteria | 1394 |
| 7 | AustNasuHG_c1029444 | 3300000089 | Bacteria | 1608 |
| 8 | JGI24698J34947_10085450 | 3300002449 | Bacteria | 1466 |
| 9 | JGI24702J35022_10618052 | 3300002462 | Bacteria | 671 |
| 10 | Ga0466698_269839 | 3300042610 | Bacteria | 1190 |
| 11 | Ga0466732_338354 | 3300042656 | Bacteria | 1938 |
| 12 | Ga0466718_028116 | 3300042617 | Bacteria | 1153 |
| 13 | Ga0466718_088326 | 3300042617 | Bacteria | 2890 |
| 14 | Ga0123356_10033168 | 3300010049 | Bacteria | 4829 |
| 15 | Ga0123356_10099856 | 3300010049 | Bacteria | 2783 |
| 16 | Ga0415639_134761 | 3300038395 | Bacteria | 1220 |
| 17 | Ga0466731_100339 | 3300042622 | Bacteria | 1086 |
| 18 | JGI24698J34947_10004368 | 3300002449 | Bacteria | 7690 |
| 19 | JGI24698J34947_10007808 | 3300002449 | Bacteria | 5878 |
| 20 | JGI24698J34947_10011595 | 3300002449 | Bacteria | 4839 |
| 21 | JGI24695J34938_10010927 | 3300002450 | Bacteria | 4929 |
| 22 | JGI24705J35276_11881532 | 3300002504 | Bacteria | 737 |
| 23 | Ga0072941_1001634 | 3300005201 | Unclassified | 16809 |
| 24 | Ga0072941_1099470 | 3300005201 | Bacteria | 1322 |
| 25 | Ga0466700_432133 | 3300042600 | Bacteria | 2428 |
| 26 | Ga0466720_063600 | 3300042607 | Bacteria | 16888 |
| 27 | Ga0466732_194248 | 3300042656 | Bacteria | 1470 |
| 28 | Ga0466712_059892 | 3300042614 | Unclassified | 7413 |
| 29 | Ga0466712_263735 | 3300042614 | Bacteria | 2658 |
| 30 | Ga0466712_315765 | 3300042614 | Unclassified | 3418 |
| 31 | Ga0466718_005913 | 3300042617 | Bacteria | 1440 |
| 32 | Ga0466718_090451 | 3300042617 | Bacteria | 4145 |
| 33 | Ga0123353_10043346 | 3300010167 | Bacteria | 7126 |
| 34 | Ga0123354_10721377 | 3300010882 | Bacteria | 691 |
| 35 | Ga0466734_099174 | 3300042623 | Bacteria | 1405 |
| 36 | JGI24698J34947_10000020 | 3300002449 | Bacteria | 40728 |
| 37 | JGI24698J34947_10017903 | 3300002449 | Bacteria | 3836 |
| 38 | Ga0072941_1013569 | 3300005201 | Bacteria | 19449 |
| 39 | Ga0466700_381176 | 3300042600 | Bacteria | 1022 |
| 40 | Ga0466707_300784 | 3300042601 | Bacteria | 1240 |
| 41 | Ga0466720_007774 | 3300042607 | Bacteria | 1476 |
| 42 | Ga0466720_078881 | 3300042607 | Bacteria | 1405 |
| 43 | Ga0466733_202424 | 3300042659 | Bacteria | 2125 |
| 44 | Ga0466712_026293 | 3300042614 | Bacteria | 3473 |
| 45 | Ga0466712_073772 | 3300042614 | Bacteria | 17253 |
| 46 | Ga0466718_114414 | 3300042617 | Bacteria | 1051 |
| 47 | Ga0123356_11079763 | 3300010049 | Bacteria | 971 |
| 48 | AustNasuHG_c1001534 | 3300000089 | Bacteria | 8303 |
| 49 | JGI24698J34947_10005944 | 3300002449 | Viruses | 6697 |
| 50 | JGI24698J34947_10014264 | 3300002449 | Bacteria | 4327 |
| 51 | JGI24698J34947_10235565 | 3300002449 | Unclassified | 693 |
| 52 | Ga0072941_1014090 | 3300005201 | Bacteria | 9640 |
| 53 | Ga0466701_073076 | 3300042598 | Bacteria | 1030 |
| 54 | Ga0466720_149539 | 3300042607 | Archaea | 3838 |
| 55 | Ga0466720_153655 | 3300042607 | Bacteria | 11118 |
| 56 | Ga0466712_018611 | 3300042614 | Bacteria | 2318 |
| 57 | Ga0466712_044180 | 3300042614 | Bacteria | 1401 |
| 58 | Ga0466712_057187 | 3300042614 | Bacteria | 36184 |
| 59 | Ga0466712_129539 | 3300042614 | Bacteria | 20112 |
| 60 | Ga0466718_033369 | 3300042617 | Bacteria | 9426 |
| 61 | Ga0123356_10853683 | 3300010049 | Bacteria | 1082 |
| 62 | Ga0123356_11181794 | 3300010049 | Bacteria | 931 |
| 63 | Ga0123356_12092662 | 3300010049 | Unclassified | 707 |
| 64 | JGI24698J34947_10004948 | 3300002449 | Bacteria | 7304 |
| 65 | JGI24698J34947_10018509 | 3300002449 | Unclassified | 3762 |
| 66 | JGI24695J34938_10123239 | 3300002450 | Bacteria | 1055 |
| 67 | Ga0072941_1047613 | 3300005201 | Bacteria | 774 |
| 68 | Ga0466720_217692 | 3300042607 | Bacteria | 5674 |
| 69 | Ga0466712_025357 | 3300042614 | Bacteria | 4496 |
| 70 | Ga0466712_268747 | 3300042614 | Bacteria | 3083 |
| 71 | Ga0123356_10004989 | 3300010049 | Bacteria | 13609 |
| 72 | Ga0123356_10099448 | 3300010049 | Bacteria | 2788 |
| 73 | Ga0466694_409593 | 3300042594 | Bacteria | 1154 |
| 74 | JGI24695J34938_10002199 | 3300002450 | Bacteria | 15201 |
| 75 | JGI24695J34938_10009797 | 3300002450 | Bacteria | 5301 |
| 76 | JGI24697J35500_10992767 | 3300002507 | Unclassified | 932 |
| 77 | JGI24696J40584_12951032 | 3300002834 | Unclassified | 2204 |
| 78 | Ga0072941_1001025 | 3300005201 | Bacteria | 54322 |
| 79 | Ga0466720_097529 | 3300042607 | Bacteria | 7721 |
| 80 | Ga0466712_033173 | 3300042614 | Bacteria | 8656 |
| 81 | Ga0466712_115286 | 3300042614 | Bacteria | 4117 |
| 82 | Ga0466712_246674 | 3300042614 | Unclassified | 17085 |
| 83 | Ga0466712_265545 | 3300042614 | Unclassified | 3361 |
| 84 | Ga0466718_044989 | 3300042617 | Unclassified | 3685 |
| 85 | Ga0123353_11754893 | 3300010167 | Bacteria | 774 |
| 86 | JGI24698J34947_10068700 | 3300002449 | Bacteria | 1713 |
| 87 | JGI24698J34947_10090213 | 3300002449 | Unclassified | 1408 |
| 88 | JGI24695J34938_10019916 | 3300002450 | Unclassified | 3312 |
| 89 | JGI24702J35022_10009916 | 3300002462 | Bacteria | 5337 |
| 90 | Ga0072941_1060901 | 3300005201 | Bacteria | 4371 |
| 91 | Ga0466713_097048 | 3300042602 | Bacteria | 2345 |
| 92 | Ga0466712_007832 | 3300042614 | Bacteria | 1390 |
| 93 | Ga0123355_10980787 | 3300009826 | Bacteria | 901 |
| 94 | Ga0123356_10022606 | 3300010049 | Unclassified | 5934 |
| 95 | Ga0123356_10419450 | 3300010049 | Bacteria | 1480 |
| 96 | Ga0123356_10844553 | 3300010049 | Bacteria | 1087 |
| 97 | Ga0466695_377359 | 3300042595 | Bacteria | 34904 |
| 98 | Ga0466731_133375 | 3300042622 | Bacteria | 7759 |
| 99 | JGI24698J34947_10037945 | 3300002449 | Bacteria | 2501 |
| 100 | JGI24698J34947_10055971 | 3300002449 | Bacteria | 1963 |
| 101 | JGI24698J34947_10109385 | 3300002449 | Bacteria | 1223 |
| 102 | JGI24702J35022_10066405 | 3300002462 | Bacteria | 1936 |
| 103 | JGI24702J35022_10140571 | 3300002462 | Bacteria | 1347 |
| 104 | Ga0072941_1026477 | 3300005201 | Bacteria | 2438 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF10543 | ORF6N | ORF6N domain | 51 | 132 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.