Protein Family IF05070
Metagenome
Metatranscriptome
Isolate
130
Members
43
Samples
121
Scaffolds
154.01
Avg Length
Representative Sequence
- ID
- 3300042595|Ga0466695_172405|Ga0466695_172405_293_835
- Length
- 180 aa
- Sequence
- MHPQMFAGVFFGRMWYNAEIGANMNVYERLKELNLTLPPRPAMGGIYKPVRQAGNCLYVSGQVASLAGEPVFPGKLGAGVTVEQGQEAARACVLNALSNLHYFFEDAGQSEGLNKIKGVIKTLAFVQSAEGFTEQPVVVNGASGLLRDIWGEDGVGARSAIGVNQLPRGVSVEIEFIFEV
Sample Types
Isolate
6.9%
Metagenome
92.3%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.8%
Kalotermitidae
21.4%
Unclassified
16.7%
Termopsidae
4.8%
Rhinotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 16 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 38 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 39 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 40 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 41 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_110561 | 3300042612 | Bacteria | 3165 |
| 2 | Ga0466732_357064 | 3300042656 | Bacteria | 4691 |
| 3 | Ga0466715_026198 | 3300042616 | Bacteria | 9768 |
| 4 | Ga0466722_261697 | 3300042609 | Bacteria | 4650 |
| 5 | Ga0123355_10000674 | 3300009826 | Bacteria | 46393 |
| 6 | Ga0123356_10024828 | 3300010049 | Bacteria | 5636 |
| 7 | Ga0123356_10139978 | 3300010049 | Bacteria | 2386 |
| 8 | Ga0123356_10732703 | 3300010049 | Bacteria | 1158 |
| 9 | Ga0123356_11754160 | 3300010049 | Bacteria | 771 |
| 10 | Ga0123356_12069641 | 3300010049 | Bacteria | 711 |
| 11 | Ga0123353_10255853 | 3300010167 | Bacteria | 2708 |
| 12 | Ga0123353_10440323 | 3300010167 | Unclassified | 1923 |
| 13 | Ga0123353_10947817 | 3300010167 | Bacteria | 1165 |
| 14 | Ga0123353_11081221 | 3300010167 | Bacteria | 1067 |
| 15 | Ga0123353_11094689 | 3300010167 | Bacteria | 1058 |
| 16 | Ga0466704_070036 | 3300042643 | Unclassified | 8019 |
| 17 | Ga0466704_474602 | 3300042643 | Unclassified | 2095 |
| 18 | Ga0466724_23838 | 3300042649 | Bacteria | 1358 |
| 19 | Ga0466727_256632 | 3300042655 | Bacteria | 5304 |
| 20 | Ga0233288_1017520 | 3300022232 | Bacteria | 878 |
| 21 | Ga0466720_037539 | 3300042607 | Bacteria | 19061 |
| 22 | Ga0466720_119891 | 3300042607 | Bacteria | 2505 |
| 23 | Ga0123355_10112553 | 3300009826 | Bacteria | 4247 |
| 24 | Ga0123356_10082343 | 3300010049 | Bacteria | 3046 |
| 25 | Ga0123356_10846825 | 3300010049 | Bacteria | 1086 |
| 26 | Ga0123353_10019493 | 3300010167 | Bacteria | 10080 |
| 27 | Ga0123353_10023205 | 3300010167 | Bacteria | 9387 |
| 28 | Ga0123353_10246795 | 3300010167 | Unclassified | 2769 |
| 29 | Ga0123353_10814173 | 3300010167 | Bacteria | 1287 |
| 30 | Ga0123353_11645008 | 3300010167 | Bacteria | 808 |
| 31 | Ga0123353_11962637 | 3300010167 | Bacteria | 719 |
| 32 | Ga0466704_380241 | 3300042643 | Bacteria | 5078 |
| 33 | Ga0264413_140864 | 3300024493 | Bacteria | 1334 |
| 34 | Ga0415639_011478 | 3300038395 | Bacteria | 2092 |
| 35 | Ga0466694_359344 | 3300042594 | Unclassified | 2353 |
| 36 | Ga0466705_043894 | 3300042612 | Unclassified | 2196 |
| 37 | Ga0466718_056998 | 3300042617 | Bacteria | 5504 |
| 38 | Ga0466718_157747 | 3300042617 | Bacteria | 11804 |
| 39 | Ga0466719_007095 | 3300042606 | Bacteria | 5030 |
| 40 | Ga0123356_10156704 | 3300010049 | Bacteria | 2269 |
| 41 | Ga0123356_10716888 | 3300010049 | Bacteria | 1170 |
| 42 | Ga0123356_13016252 | 3300010049 | Bacteria | 588 |
| 43 | Ga0123353_10044883 | 3300010167 | Bacteria | 7010 |
| 44 | Ga0123353_10142776 | 3300010167 | Bacteria | 3833 |
| 45 | Ga0123353_10440918 | 3300010167 | Bacteria | 1921 |
| 46 | Ga0123353_10622152 | 3300010167 | Bacteria | 1537 |
| 47 | Ga0123354_10291504 | 3300010882 | Unclassified | 1563 |
| 48 | Ga0466731_167904 | 3300042622 | Bacteria | 1703 |
| 49 | Ga0415639_008409 | 3300038395 | Bacteria | 2686 |
| 50 | Ga0123355_10313242 | 3300009826 | Bacteria | 2124 |
| 51 | Ga0123356_10128871 | 3300010049 | Bacteria | 2475 |
| 52 | Ga0123356_10144043 | 3300010049 | Bacteria | 2355 |
| 53 | Ga0123356_10299670 | 3300010049 | Bacteria | 1712 |
| 54 | Ga0123356_10799080 | 3300010049 | Bacteria | 1114 |
| 55 | Ga0123356_12387544 | 3300010049 | Bacteria | 662 |
| 56 | Ga0123353_11706359 | 3300010167 | Bacteria | 788 |
| 57 | Ga0123353_12757669 | 3300010167 | Bacteria | 577 |
| 58 | JGI24698J34947_10033525 | 3300002449 | Bacteria | 2693 |
| 59 | JGI24698J34947_10126486 | 3300002449 | Bacteria | 1100 |
| 60 | Ga0466709_030048 | 3300042648 | Unclassified | 1150 |
| 61 | Ga0466695_172405 | 3300042595 | Bacteria | 1169 |
| 62 | Ga0466720_058527 | 3300042607 | Bacteria | 39738 |
| 63 | Ga0123355_10120612 | 3300009826 | Bacteria | 4069 |
| 64 | Ga0123356_10001854 | 3300010049 | Bacteria | 22934 |
| 65 | Ga0123356_10351558 | 3300010049 | Bacteria | 1598 |
| 66 | Ga0123356_10745776 | 3300010049 | Bacteria | 1149 |
| 67 | Ga0123356_11292386 | 3300010049 | Bacteria | 893 |
| 68 | Ga0123356_12795120 | 3300010049 | Bacteria | 611 |
| 69 | Ga0123353_10135374 | 3300010167 | Bacteria | 3951 |
| 70 | Ga0123353_11142013 | 3300010167 | Unclassified | 1029 |
| 71 | JGI24698J34947_10152123 | 3300002449 | Bacteria | 959 |
| 72 | JGI24703J35330_11748826 | 3300002501 | Bacteria | 41326 |
| 73 | Ga0466735_119920 | 3300042624 | Bacteria | 2244 |
| 74 | Ga0466704_363528 | 3300042643 | Unclassified | 1689 |
| 75 | Ga0264413_154640 | 3300024493 | Bacteria | 1903 |
| 76 | Ga0415639_161167 | 3300038395 | Bacteria | 1940 |
| 77 | Ga0466728_274316 | 3300042620 | Bacteria | 4658 |
| 78 | Ga0466700_330066 | 3300042600 | Bacteria | 1647 |
| 79 | Ga0466722_031325 | 3300042609 | Bacteria | 3310 |
| 80 | Ga0123356_10462716 | 3300010049 | Bacteria | 1418 |
| 81 | Ga0123356_13187281 | 3300010049 | Bacteria | 571 |
| 82 | Ga0123353_11200457 | 3300010167 | Bacteria | 996 |
| 83 | Ga0123353_11376205 | 3300010167 | Bacteria | 909 |
| 84 | Ga0123354_10204729 | 3300010882 | Unclassified | 2155 |
| 85 | Ga0123354_10267158 | 3300010882 | Unclassified | 1693 |
| 86 | Ga0123354_10427444 | 3300010882 | Bacteria | 1094 |
| 87 | Ga0466693_050756 | 3300042592 | Bacteria | 37656 |
| 88 | Ga0466694_286906 | 3300042594 | Bacteria | 1425 |
| 89 | Ga0466696_013612 | 3300042596 | Bacteria | 1900 |
| 90 | Ga0466701_001668 | 3300042598 | Bacteria | 1500 |
| 91 | Ga0466705_027862 | 3300042612 | Unclassified | 1536 |
| 92 | Ga0466723_005692 | 3300042618 | Bacteria | 2065 |
| 93 | Ga0466728_102830 | 3300042620 | Bacteria | 4519 |
| 94 | Ga0466728_204385 | 3300042620 | Bacteria | 3481 |
| 95 | Ga0123355_10402922 | 3300009826 | Bacteria | 1763 |
| 96 | Ga0123356_10009055 | 3300010049 | Bacteria | 9845 |
| 97 | Ga0123356_10011350 | 3300010049 | Bacteria | 8689 |
| 98 | Ga0123353_10533428 | 3300010167 | Bacteria | 1698 |
| 99 | Ga0123353_10692768 | 3300010167 | Bacteria | 1432 |
| 100 | Ga0123353_10790473 | 3300010167 | Bacteria | 1312 |
| 101 | Ga0123353_11006285 | 3300010167 | Bacteria | 1119 |
| 102 | Ga0123353_12326319 | 3300010167 | Bacteria | 643 |
| 103 | AustNasuHG_c1001437 | 3300000089 | Bacteria | 8528 |
| 104 | JGI24702J35022_10014499 | 3300002462 | Bacteria | 4349 |
| 105 | Ga0072940_1090544 | 3300005200 | Unclassified | 2625 |
| 106 | Ga0466705_145152 | 3300042612 | Bacteria | 2063 |
| 107 | Ga0466712_247977 | 3300042614 | Bacteria | 1745 |
| 108 | Ga0466701_097602 | 3300042598 | Bacteria | 1115 |
| 109 | Ga0123356_10573399 | 3300010049 | Bacteria | 1291 |
| 110 | Ga0123356_11099477 | 3300010049 | Bacteria | 963 |
| 111 | Ga0123353_10072786 | 3300010167 | Bacteria | 5523 |
| 112 | Ga0123353_10271746 | 3300010167 | Bacteria | 2611 |
| 113 | Ga0123353_10300230 | 3300010167 | Bacteria | 2452 |
| 114 | Ga0123353_11095782 | 3300010167 | Bacteria | 1058 |
| 115 | Ga0123353_11270980 | 3300010167 | Bacteria | 959 |
| 116 | Ga0123353_11581150 | 3300010167 | Bacteria | 829 |
| 117 | Ga0123353_11737477 | 3300010167 | Bacteria | 779 |
| 118 | Ga0123354_10230802 | 3300010882 | Bacteria | 1935 |
| 119 | Ga0466704_141200 | 3300042643 | Bacteria | 40736 |
| 120 | Ga0466691_088440 | 3300042593 | Bacteria | 7226 |
| 121 | Ga0466699_364167 | 3300042597 | Bacteria | 1373 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.