Protein Family IF05029
Metagenome
Isolate
141
Members
33
Samples
140
Scaffolds
106.97
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_271487|Ga0466694_271487_515_844
- Length
- 102 aa
- Sequence
- MGLVMEQYSICLVNLEPSIGHEIKKTRPCVIISPNEMNQHIMTTKSHAYPTRVPLTFQGKKGWIVLDQIRTVDKRRIIKKLGKLTSNKITEVKNIINEMLVE
Sample Types
Isolate
0.7%
Metagenome
99.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
73.3%
Kalotermitidae
10.0%
Termopsidae
10.0%
Unclassified
6.7%
Taxonomy
Archaea
2
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 21 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 25 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 26 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 27 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 28 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_113541 | 3300024493 | Bacteria | 3195 |
| 2 | Ga0466694_018450 | 3300042594 | Bacteria | 43707 |
| 3 | Ga0466707_028122 | 3300042601 | Archaea | 2029 |
| 4 | Ga0466720_072162 | 3300042607 | Bacteria | 7077 |
| 5 | Ga0123355_12145442 | 3300009826 | Bacteria | 512 |
| 6 | Ga0123356_10390562 | 3300010049 | Unclassified | 1527 |
| 7 | Ga0123356_10615425 | 3300010049 | Bacteria | 1251 |
| 8 | Ga0123353_11762558 | 3300010167 | Bacteria | 772 |
| 9 | AustNasuHG_c1035162 | 3300000089 | Bacteria | 1325 |
| 10 | JGI24698J34947_10000374 | 3300002449 | Bacteria | 20110 |
| 11 | JGI24698J34947_10062376 | 3300002449 | Bacteria | 1830 |
| 12 | Ga0466712_009738 | 3300042614 | Bacteria | 1155 |
| 13 | Ga0466712_107930 | 3300042614 | Unclassified | 2347 |
| 14 | Ga0466715_045708 | 3300042616 | Bacteria | 39702 |
| 15 | Ga0466718_051732 | 3300042617 | Bacteria | 3673 |
| 16 | Ga0466718_117446 | 3300042617 | Bacteria | 1099 |
| 17 | Ga0466732_213060 | 3300042656 | Archaea | 7062 |
| 18 | Ga0264413_120926 | 3300024493 | Bacteria | 1360 |
| 19 | Ga0466690_254894 | 3300042590 | Bacteria | 2208 |
| 20 | Ga0466720_036539 | 3300042607 | Unclassified | 1789 |
| 21 | Ga0466720_122527 | 3300042607 | Bacteria | 2064 |
| 22 | Ga0466720_148186 | 3300042607 | Bacteria | 6706 |
| 23 | Ga0466721_225174 | 3300042608 | Bacteria | 32299 |
| 24 | Ga0466698_273433 | 3300042610 | Bacteria | 2068 |
| 25 | AustNasuHG_c1042371 | 3300000089 | Bacteria | 1084 |
| 26 | JGI24695J34938_10006294 | 3300002450 | Bacteria | 7183 |
| 27 | Ga0072941_1038330 | 3300005201 | Bacteria | 3532 |
| 28 | Ga0466708_074415 | 3300042652 | Unclassified | 1753 |
| 29 | Ga0466712_145146 | 3300042614 | Bacteria | 2587 |
| 30 | Ga0466712_188420 | 3300042614 | Bacteria | 6034 |
| 31 | Ga0466715_187254 | 3300042616 | Bacteria | 3946 |
| 32 | Ga0466718_019708 | 3300042617 | Bacteria | 18835 |
| 33 | Ga0466718_029097 | 3300042617 | Unclassified | 8123 |
| 34 | Ga0466718_059094 | 3300042617 | Bacteria | 1533 |
| 35 | Ga0264413_110642 | 3300024493 | Unclassified | 3692 |
| 36 | Ga0466694_334975 | 3300042594 | Bacteria | 6999 |
| 37 | Ga0466720_232163 | 3300042607 | Unclassified | 7266 |
| 38 | Ga0466720_234123 | 3300042607 | Bacteria | 2815 |
| 39 | Ga0123353_10523256 | 3300010167 | Bacteria | 1720 |
| 40 | Ga0123353_11205317 | 3300010167 | Bacteria | 993 |
| 41 | Ga0123353_11922452 | 3300010167 | Bacteria | 729 |
| 42 | AustNasuHG_c1002394 | 3300000089 | Bacteria | 6772 |
| 43 | Ga0466712_000188 | 3300042614 | Bacteria | 6847 |
| 44 | Ga0466712_180166 | 3300042614 | Unclassified | 1160 |
| 45 | Ga0466712_226367 | 3300042614 | Bacteria | 4401 |
| 46 | Ga0466712_286235 | 3300042614 | Bacteria | 1402 |
| 47 | Ga0466718_013780 | 3300042617 | Bacteria | 1280 |
| 48 | Ga0466718_026871 | 3300042617 | Bacteria | 1201 |
| 49 | Ga0466726_364058 | 3300042619 | Bacteria | 1306 |
| 50 | Ga0264413_103890 | 3300024493 | Bacteria | 7028 |
| 51 | Ga0466694_093765 | 3300042594 | Bacteria | 40261 |
| 52 | Ga0123353_12057996 | 3300010167 | Bacteria | 697 |
| 53 | Ga0123354_10118317 | 3300010882 | Unclassified | 3441 |
| 54 | AustNasuHG_c1025212 | 3300000089 | Bacteria | 1872 |
| 55 | JGI24698J34947_10001711 | 3300002449 | Unclassified | 11685 |
| 56 | JGI24698J34947_10002446 | 3300002449 | Bacteria | 10005 |
| 57 | JGI24698J34947_10002872 | 3300002449 | Bacteria | 9347 |
| 58 | JGI24698J34947_10288204 | 3300002449 | Bacteria | 597 |
| 59 | Ga0072940_1023916 | 3300005200 | Unclassified | 1866 |
| 60 | Ga0072940_1032669 | 3300005200 | Unclassified | 2008 |
| 61 | Ga0072940_1088418 | 3300005200 | Bacteria | 806 |
| 62 | Ga0466727_300820 | 3300042655 | Bacteria | 3162 |
| 63 | Ga0466718_045188 | 3300042617 | Bacteria | 1051 |
| 64 | Ga0466732_319319 | 3300042656 | Bacteria | 1590 |
| 65 | Ga0466732_382113 | 3300042656 | Bacteria | 18383 |
| 66 | Ga0466700_305532 | 3300042600 | Bacteria | 1910 |
| 67 | Ga0466707_153659 | 3300042601 | Bacteria | 1536 |
| 68 | Ga0466720_206285 | 3300042607 | Bacteria | 2817 |
| 69 | Ga0123357_10773424 | 3300009784 | Bacteria | 659 |
| 70 | Ga0123353_10479072 | 3300010167 | Bacteria | 1821 |
| 71 | Ga0123353_11606671 | 3300010167 | Bacteria | 821 |
| 72 | AustNasuHG_c1075072 | 3300000089 | Unclassified | 592 |
| 73 | JGI24698J34947_10025002 | 3300002449 | Bacteria | 3182 |
| 74 | JGI24698J34947_10134469 | 3300002449 | Bacteria | 1052 |
| 75 | JGI24698J34947_10286439 | 3300002449 | Bacteria | 600 |
| 76 | Ga0466712_019849 | 3300042614 | Bacteria | 3200 |
| 77 | Ga0466732_254485 | 3300042656 | Bacteria | 1097 |
| 78 | Ga0264413_100883 | 3300024493 | Bacteria | 42424 |
| 79 | Ga0466694_051305 | 3300042594 | Bacteria | 5377 |
| 80 | Ga0466720_203269 | 3300042607 | Bacteria | 1777 |
| 81 | AustNasuHG_c1018264 | 3300000089 | Bacteria | 2318 |
| 82 | AustNasuHG_c1051377 | 3300000089 | Unclassified | 877 |
| 83 | JGI24698J34947_10006536 | 3300002449 | Bacteria | 6398 |
| 84 | JGI24698J34947_10071523 | 3300002449 | Unclassified | 1664 |
| 85 | JGI24698J34947_10100166 | 3300002449 | Bacteria | 1305 |
| 86 | JGI24698J34947_10314592 | 3300002449 | Bacteria | 559 |
| 87 | JGI24695J34938_10001573 | 3300002450 | Bacteria | 19221 |
| 88 | JGI24702J35022_10065055 | 3300002462 | Bacteria | 1956 |
| 89 | JGI24696J40584_12951336 | 3300002834 | Bacteria | 2233 |
| 90 | Ga0072940_1139372 | 3300005200 | Unclassified | 1249 |
| 91 | Ga0466702_136951 | 3300042635 | Bacteria | 1132 |
| 92 | Ga0466702_370613 | 3300042635 | Unclassified | 1311 |
| 93 | Ga0466727_208699 | 3300042655 | Bacteria | 9767 |
| 94 | Ga0466712_012588 | 3300042614 | Bacteria | 1967 |
| 95 | Ga0466712_081897 | 3300042614 | Bacteria | 8697 |
| 96 | Ga0466718_158902 | 3300042617 | Unclassified | 4037 |
| 97 | Ga0264413_133966 | 3300024493 | Unclassified | 1031 |
| 98 | Ga0466694_271487 | 3300042594 | Bacteria | 1071 |
| 99 | Ga0466699_073492 | 3300042597 | Bacteria | 3531 |
| 100 | Ga0466720_066961 | 3300042607 | Bacteria | 14297 |
| 101 | Ga0466720_076955 | 3300042607 | Bacteria | 2349 |
| 102 | Ga0466720_149081 | 3300042607 | Bacteria | 75517 |
| 103 | Ga0466720_207068 | 3300042607 | Unclassified | 2028 |
| 104 | Ga0123357_10407977 | 3300009784 | Bacteria | 1228 |
| 105 | Ga0123353_10536729 | 3300010167 | Bacteria | 1692 |
| 106 | Ga0123353_12371352 | 3300010167 | Bacteria | 636 |
| 107 | AustNasuHG_c1021757 | 3300000089 | Bacteria | 2070 |
| 108 | FAAS_10351970 | 3300001880 | Bacteria | 541 |
| 109 | JGI24698J34947_10039961 | 3300002449 | Bacteria | 2425 |
| 110 | JGI24698J34947_10110639 | 3300002449 | Bacteria | 1213 |
| 111 | JGI24698J34947_10236001 | 3300002449 | Unclassified | 692 |
| 112 | Ga0466735_144648 | 3300042624 | Bacteria | 1014 |
| 113 | Ga0466712_006332 | 3300042614 | Unclassified | 1881 |
| 114 | Ga0466712_009306 | 3300042614 | Unclassified | 8618 |
| 115 | Ga0466712_161488 | 3300042614 | Bacteria | 2390 |
| 116 | Ga0466712_199313 | 3300042614 | Unclassified | 2121 |
| 117 | Ga0466718_097301 | 3300042617 | Bacteria | 1039 |
| 118 | Ga0466732_345681 | 3300042656 | Bacteria | 9324 |
| 119 | Ga0466732_391645 | 3300042656 | Bacteria | 3036 |
| 120 | Ga0264413_126644 | 3300024493 | Unclassified | 2804 |
| 121 | Ga0466693_369496 | 3300042592 | Bacteria | 1465 |
| 122 | Ga0466707_076811 | 3300042601 | Bacteria | 2730 |
| 123 | Ga0466720_040357 | 3300042607 | Bacteria | 25359 |
| 124 | Ga0466698_182993 | 3300042610 | Bacteria | 2882 |
| 125 | Ga0123357_10035422 | 3300009784 | Bacteria | 6786 |
| 126 | Ga0123356_10700679 | 3300010049 | Unclassified | 1182 |
| 127 | AustNasuHG_c1001174 | 3300000089 | Bacteria | 9408 |
| 128 | AustNasuHG_c1029622 | 3300000089 | Unclassified | 1597 |
| 129 | FAAS_10579152 | 3300001880 | Unclassified | 524 |
| 130 | JGI24698J34947_10036105 | 3300002449 | Unclassified | 2575 |
| 131 | JGI24698J34947_10197907 | 3300002449 | Unclassified | 789 |
| 132 | JGI24695J34938_10005234 | 3300002450 | Bacteria | 8177 |
| 133 | JGI24695J34938_10205619 | 3300002450 | Bacteria | 822 |
| 134 | Ga0072940_1022527 | 3300005200 | Bacteria | 6111 |
| 135 | Ga0072940_1117403 | 3300005200 | Bacteria | 789 |
| 136 | Ga0466702_418100 | 3300042635 | Bacteria | 1369 |
| 137 | Ga0466727_170053 | 3300042655 | Bacteria | 2985 |
| 138 | Ga0466718_014411 | 3300042617 | Bacteria | 1386 |
| 139 | Ga0466718_050990 | 3300042617 | Unclassified | 1680 |
| 140 | Ga0466718_054558 | 3300042617 | Bacteria | 23512 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02452 | PemK_toxin | PemK-like, MazF-like toxin of type II toxin-antitoxin system | 7 | 100 | 0.92 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02452 | GO:0003677 | DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.