Protein Family IF04998

Metagenome Isolate
157 Members
53 Samples
147 Scaffolds
212.73 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_116026|Ga0466694_116026_16654_17403
Length
249 aa
Sequence
VLKIYNSRRRLTPEDSLYFVRLKIFAGFVYNKTGAKMIELAVFFGNPGTEYASNRHNAGRMLAQALPIYTSLSWQKKFKGLYAFNEGSHFLMPETYMNLSGESVFAAASFYKIKIEQIIVVHDELELPLGTISLKFSGGLGGHNGLRSMKQCFGNADFWRLRIGLGRPDSRLPGEGGRGGLENRESGEGIVDWVLSDFSCVEKEALAPVFESGASLLIQAMNVDPQTLLPEWAKKKINIAAKEENNDSR

πŸ“Š Sample Types

Isolate 6.4%
Metagenome 93.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 43.1%
Kalotermitidae 23.5%
Unclassified 21.6%
Rhinotermitidae 5.9%
Termopsidae 5.9%

🌳 Taxonomy

Archaea 1
Bacteria 140
Eukaryota 0
Viruses 0
Unclassified 16

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
2 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
3 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
4 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
5 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
6 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
7 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
8 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
12 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
13 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
17 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
20 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
24 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
25 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
28 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
32 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
33 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
34 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
35 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
36 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
37 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
38 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
41 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
42 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
43 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
44 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
47 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
48 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
52 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
53 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10000454 3300010049 Bacteria 46012
2 Ga0123356_10023032 3300010049 Bacteria 5870
3 Ga0123353_10304190 3300010167 Bacteria 2432
4 Ga0466731_270198 3300042622 Bacteria 1295
5 Ga0466703_177275 3300042636 Bacteria 42729
6 Ga0466704_583556 3300042643 Bacteria 17730
7 Ga0466708_223819 3300042652 Bacteria 4810
8 Ga0466691_002695 3300042593 Bacteria 29435
9 Ga0466691_061063 3300042593 Bacteria 9624
10 Ga0466700_066888 3300042600 Bacteria 2846
11 Ga0466720_015977 3300042607 Bacteria 14141
12 Ga0466722_012195 3300042609 Bacteria 4696
13 JGI24698J34947_10075870 3300002449 Bacteria 1596
14 Ga0466712_049671 3300042614 Bacteria 6385
15 Ga0466712_259339 3300042614 Bacteria 4096
16 Ga0123356_10000624 3300010049 Bacteria 39100
17 Ga0123356_11215057 3300010049 Bacteria 919
18 Ga0123356_11530297 3300010049 Bacteria 824
19 Ga0466729_225272 3300042621 Bacteria 1280
20 Ga0415639_022950 3300038395 Bacteria 10341
21 Ga0466692_155126 3300042591 Bacteria 2075
22 Ga0466696_198633 3300042596 Bacteria 12905
23 Ga0466717_271457 3300042604 Bacteria 1163
24 JGI24698J34947_10028952 3300002449 Bacteria 2931
25 Ga0072941_1008248 3300005201 Bacteria 12080
26 Ga0072941_1036346 3300005201 Bacteria 1687
27 Ga0466712_004752 3300042614 Bacteria 3666
28 Ga0466712_072051 3300042614 Bacteria 23884
29 Ga0466712_233424 3300042614 Bacteria 2474
30 Ga0466723_266535 3300042618 Bacteria 11967
31 Ga0466726_035181 3300042619 Bacteria 2480
32 Ga0123356_10130594 3300010049 Bacteria 2460
33 Ga0123356_10136799 3300010049 Bacteria 2410
34 Ga0123353_10007548 3300010167 Bacteria 14727
35 Ga0466731_425692 3300042622 Bacteria 1402
36 Ga0466709_263566 3300042648 Unclassified 4557
37 Ga0466708_147157 3300042652 Bacteria 5932
38 Ga0466727_139071 3300042655 Bacteria 4209
39 Ga0466690_120585 3300042590 Bacteria 5733
40 Ga0466720_035637 3300042607 Bacteria 1734
41 JGI24698J34947_10005756 3300002449 Bacteria 6796
42 JGI24700J35501_10834935 3300002508 Bacteria 1814
43 Ga0466712_194073 3300042614 Bacteria 10983
44 Ga0466715_284748 3300042616 Bacteria 33200
45 Ga0466726_360511 3300042619 Unclassified 1467
46 Ga0466732_058793 3300042656 Bacteria 1717
47 Ga0123356_10026863 3300010049 Bacteria 5398
48 Ga0123356_10028400 3300010049 Unclassified 5241
49 Ga0123353_10153152 3300010167 Bacteria 3679
50 Ga0466704_147969 3300042643 Unclassified 7871
51 Ga0466704_202884 3300042643 Bacteria 2075
52 Ga0264413_101220 3300024493 Bacteria 47245
53 Ga0415639_117602 3300038395 Bacteria 4131
54 Ga0466694_116026 3300042594 Bacteria 17934
55 Ga0466699_300572 3300042597 Bacteria 3097
56 Ga0466707_316679 3300042601 Bacteria 1023
57 JGI24698J34947_10006637 3300002449 Bacteria 6356
58 JGI24698J34947_10009209 3300002449 Bacteria 5419
59 JGI24698J34947_10065161 3300002449 Unclassified 1777
60 JGI24695J34938_10001293 3300002450 Bacteria 21940
61 JGI24695J34938_10001758 3300002450 Bacteria 17891
62 JGI24695J34938_10068938 3300002450 Bacteria 1484
63 JGI24697J35500_11273289 3300002507 Unclassified 5519
64 Ga0072941_1052663 3300005201 Bacteria 1025
65 Ga0466712_227385 3300042614 Bacteria 1542
66 Ga0466712_299142 3300042614 Bacteria 10125
67 Ga0466711_122592 3300042615 Bacteria 2590
68 Ga0466726_331156 3300042619 Archaea 1508
69 Ga0466705_059310 3300042612 Bacteria 4919
70 Ga0466731_080485 3300042622 Bacteria 1163
71 Ga0466702_008851 3300042635 Bacteria 1200
72 Ga0466703_078559 3300042636 Bacteria 3887
73 Ga0466704_059474 3300042643 Bacteria 8080
74 Ga0415639_026713 3300038395 Bacteria 6865
75 Ga0466700_077650 3300042600 Bacteria 1278
76 Ga0466720_159486 3300042607 Bacteria 1502
77 JGI24695J34938_10059535 3300002450 Bacteria 1633
78 Ga0072941_1144569 3300005201 Bacteria 4028
79 Ga0466712_053113 3300042614 Bacteria 11639
80 Ga0466712_090702 3300042614 Bacteria 15005
81 Ga0466712_206744 3300042614 Bacteria 4863
82 Ga0466712_236994 3300042614 Unclassified 2251
83 Ga0466715_309831 3300042616 Bacteria 1557
84 Ga0466715_345203 3300042616 Bacteria 7760
85 Ga0466723_326899 3300042618 Bacteria 5743
86 Ga0466705_122991 3300042612 Unclassified 3628
87 Ga0466732_041243 3300042656 Bacteria 5736
88 Ga0123356_10007516 3300010049 Bacteria 10864
89 Ga0123353_11073698 3300010167 Unclassified 1072
90 Ga0466731_057013 3300042622 Bacteria 49553
91 Ga0466731_183486 3300042622 Bacteria 3923
92 Ga0466696_123055 3300042596 Bacteria 16521
93 Ga0466707_000975 3300042601 Bacteria 1103
94 Ga0466707_200988 3300042601 Bacteria 7366
95 Ga0466719_372001 3300042606 Bacteria 15055
96 JGI24698J34947_10023252 3300002449 Bacteria 3317
97 JGI24698J34947_10042266 3300002449 Bacteria 2343
98 JGI24698J34947_10044798 3300002449 Bacteria 2262
99 JGI24695J34938_10000090 3300002450 Bacteria 79670
100 JGI24695J34938_10000341 3300002450 Bacteria 46027
101 Ga0072940_1012279 3300005200 Bacteria 17174
102 Ga0466712_001885 3300042614 Bacteria 9309
103 Ga0466726_001787 3300042619 Bacteria 1873
104 Ga0466726_494002 3300042619 Unclassified 1560
105 Ga0466733_064703 3300042659 Bacteria 1631
106 Ga0123355_11351557 3300009826 Bacteria 709
107 Ga0123356_10076954 3300010049 Bacteria 3145
108 Ga0123356_10271217 3300010049 Bacteria 1787
109 Ga0466735_188905 3300042624 Bacteria 1019
110 Ga0466702_060692 3300042635 Bacteria 1234
111 Ga0466703_045349 3300042636 Unclassified 3365
112 Ga0466692_004082 3300042591 Bacteria 1201
113 Ga0466699_388666 3300042597 Unclassified 1669
114 Ga0466707_047199 3300042601 Unclassified 2932
115 Ga0466707_097853 3300042601 Bacteria 2467
116 Ga0466707_334456 3300042601 Bacteria 1078
117 Ga0466722_253337 3300042609 Bacteria 1520
118 Ga0466698_248910 3300042610 Bacteria 3010
119 AustNasuHG_c1015590 3300000089 Bacteria 2561
120 JGI24698J34947_10000307 3300002449 Bacteria 21485
121 JGI24698J34947_10003378 3300002449 Bacteria 8662
122 JGI24698J34947_10004609 3300002449 Bacteria 7513
123 JGI24698J34947_10023605 3300002449 Unclassified 3290
124 JGI24698J34947_10056457 3300002449 Bacteria 1952
125 JGI24695J34938_10000234 3300002450 Bacteria 52922
126 Ga0072941_1000337 3300005201 Bacteria 38663
127 Ga0466712_031932 3300042614 Bacteria 31317
128 Ga0466712_032344 3300042614 Bacteria 20671
129 Ga0466712_155391 3300042614 Bacteria 4723
130 Ga0466715_625328 3300042616 Bacteria 3958
131 Ga0466726_039827 3300042619 Bacteria 1833
132 Ga0466705_336433 3300042612 Unclassified 4131
133 Ga0123356_10025561 3300010049 Bacteria 5550
134 Ga0123353_10081628 3300010167 Bacteria 5199
135 Ga0123353_10217903 3300010167 Bacteria 2988
136 Ga0466731_203709 3300042622 Unclassified 1020
137 Ga0466735_131689 3300042624 Bacteria 1543
138 Ga0466708_107238 3300042652 Bacteria 24038
139 Ga0466727_104177 3300042655 Bacteria 1750
140 Ga0415639_076684 3300038395 Bacteria 4913
141 Ga0466696_090089 3300042596 Bacteria 1443
142 Ga0466721_232641 3300042608 Bacteria 2670
143 Ga0466722_036821 3300042609 Bacteria 1051
144 AustNasuHG_c1004095 3300000089 Bacteria 5238
145 Ga0466712_009954 3300042614 Bacteria 9507
146 Ga0466712_289776 3300042614 Bacteria 27357
147 Ga0466711_116093 3300042615 Bacteria 4264

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase 41 221 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01195 GO:0004045 aminoacyl-tRNA hydrolase activity MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.