Protein Family IF04998
Metagenome
Isolate
157
Members
53
Samples
147
Scaffolds
212.73
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_116026|Ga0466694_116026_16654_17403
- Length
- 249 aa
- Sequence
- VLKIYNSRRRLTPEDSLYFVRLKIFAGFVYNKTGAKMIELAVFFGNPGTEYASNRHNAGRMLAQALPIYTSLSWQKKFKGLYAFNEGSHFLMPETYMNLSGESVFAAASFYKIKIEQIIVVHDELELPLGTISLKFSGGLGGHNGLRSMKQCFGNADFWRLRIGLGRPDSRLPGEGGRGGLENRESGEGIVDWVLSDFSCVEKEALAPVFESGASLLIQAMNVDPQTLLPEWAKKKINIAAKEENNDSR
Sample Types
Isolate
6.4%
Metagenome
93.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.1%
Kalotermitidae
23.5%
Unclassified
21.6%
Rhinotermitidae
5.9%
Termopsidae
5.9%
Taxonomy
Archaea
1
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 2 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 3 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 4 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 5 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 6 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 7 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 8 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 42 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 43 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 44 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 53 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10000454 | 3300010049 | Bacteria | 46012 |
| 2 | Ga0123356_10023032 | 3300010049 | Bacteria | 5870 |
| 3 | Ga0123353_10304190 | 3300010167 | Bacteria | 2432 |
| 4 | Ga0466731_270198 | 3300042622 | Bacteria | 1295 |
| 5 | Ga0466703_177275 | 3300042636 | Bacteria | 42729 |
| 6 | Ga0466704_583556 | 3300042643 | Bacteria | 17730 |
| 7 | Ga0466708_223819 | 3300042652 | Bacteria | 4810 |
| 8 | Ga0466691_002695 | 3300042593 | Bacteria | 29435 |
| 9 | Ga0466691_061063 | 3300042593 | Bacteria | 9624 |
| 10 | Ga0466700_066888 | 3300042600 | Bacteria | 2846 |
| 11 | Ga0466720_015977 | 3300042607 | Bacteria | 14141 |
| 12 | Ga0466722_012195 | 3300042609 | Bacteria | 4696 |
| 13 | JGI24698J34947_10075870 | 3300002449 | Bacteria | 1596 |
| 14 | Ga0466712_049671 | 3300042614 | Bacteria | 6385 |
| 15 | Ga0466712_259339 | 3300042614 | Bacteria | 4096 |
| 16 | Ga0123356_10000624 | 3300010049 | Bacteria | 39100 |
| 17 | Ga0123356_11215057 | 3300010049 | Bacteria | 919 |
| 18 | Ga0123356_11530297 | 3300010049 | Bacteria | 824 |
| 19 | Ga0466729_225272 | 3300042621 | Bacteria | 1280 |
| 20 | Ga0415639_022950 | 3300038395 | Bacteria | 10341 |
| 21 | Ga0466692_155126 | 3300042591 | Bacteria | 2075 |
| 22 | Ga0466696_198633 | 3300042596 | Bacteria | 12905 |
| 23 | Ga0466717_271457 | 3300042604 | Bacteria | 1163 |
| 24 | JGI24698J34947_10028952 | 3300002449 | Bacteria | 2931 |
| 25 | Ga0072941_1008248 | 3300005201 | Bacteria | 12080 |
| 26 | Ga0072941_1036346 | 3300005201 | Bacteria | 1687 |
| 27 | Ga0466712_004752 | 3300042614 | Bacteria | 3666 |
| 28 | Ga0466712_072051 | 3300042614 | Bacteria | 23884 |
| 29 | Ga0466712_233424 | 3300042614 | Bacteria | 2474 |
| 30 | Ga0466723_266535 | 3300042618 | Bacteria | 11967 |
| 31 | Ga0466726_035181 | 3300042619 | Bacteria | 2480 |
| 32 | Ga0123356_10130594 | 3300010049 | Bacteria | 2460 |
| 33 | Ga0123356_10136799 | 3300010049 | Bacteria | 2410 |
| 34 | Ga0123353_10007548 | 3300010167 | Bacteria | 14727 |
| 35 | Ga0466731_425692 | 3300042622 | Bacteria | 1402 |
| 36 | Ga0466709_263566 | 3300042648 | Unclassified | 4557 |
| 37 | Ga0466708_147157 | 3300042652 | Bacteria | 5932 |
| 38 | Ga0466727_139071 | 3300042655 | Bacteria | 4209 |
| 39 | Ga0466690_120585 | 3300042590 | Bacteria | 5733 |
| 40 | Ga0466720_035637 | 3300042607 | Bacteria | 1734 |
| 41 | JGI24698J34947_10005756 | 3300002449 | Bacteria | 6796 |
| 42 | JGI24700J35501_10834935 | 3300002508 | Bacteria | 1814 |
| 43 | Ga0466712_194073 | 3300042614 | Bacteria | 10983 |
| 44 | Ga0466715_284748 | 3300042616 | Bacteria | 33200 |
| 45 | Ga0466726_360511 | 3300042619 | Unclassified | 1467 |
| 46 | Ga0466732_058793 | 3300042656 | Bacteria | 1717 |
| 47 | Ga0123356_10026863 | 3300010049 | Bacteria | 5398 |
| 48 | Ga0123356_10028400 | 3300010049 | Unclassified | 5241 |
| 49 | Ga0123353_10153152 | 3300010167 | Bacteria | 3679 |
| 50 | Ga0466704_147969 | 3300042643 | Unclassified | 7871 |
| 51 | Ga0466704_202884 | 3300042643 | Bacteria | 2075 |
| 52 | Ga0264413_101220 | 3300024493 | Bacteria | 47245 |
| 53 | Ga0415639_117602 | 3300038395 | Bacteria | 4131 |
| 54 | Ga0466694_116026 | 3300042594 | Bacteria | 17934 |
| 55 | Ga0466699_300572 | 3300042597 | Bacteria | 3097 |
| 56 | Ga0466707_316679 | 3300042601 | Bacteria | 1023 |
| 57 | JGI24698J34947_10006637 | 3300002449 | Bacteria | 6356 |
| 58 | JGI24698J34947_10009209 | 3300002449 | Bacteria | 5419 |
| 59 | JGI24698J34947_10065161 | 3300002449 | Unclassified | 1777 |
| 60 | JGI24695J34938_10001293 | 3300002450 | Bacteria | 21940 |
| 61 | JGI24695J34938_10001758 | 3300002450 | Bacteria | 17891 |
| 62 | JGI24695J34938_10068938 | 3300002450 | Bacteria | 1484 |
| 63 | JGI24697J35500_11273289 | 3300002507 | Unclassified | 5519 |
| 64 | Ga0072941_1052663 | 3300005201 | Bacteria | 1025 |
| 65 | Ga0466712_227385 | 3300042614 | Bacteria | 1542 |
| 66 | Ga0466712_299142 | 3300042614 | Bacteria | 10125 |
| 67 | Ga0466711_122592 | 3300042615 | Bacteria | 2590 |
| 68 | Ga0466726_331156 | 3300042619 | Archaea | 1508 |
| 69 | Ga0466705_059310 | 3300042612 | Bacteria | 4919 |
| 70 | Ga0466731_080485 | 3300042622 | Bacteria | 1163 |
| 71 | Ga0466702_008851 | 3300042635 | Bacteria | 1200 |
| 72 | Ga0466703_078559 | 3300042636 | Bacteria | 3887 |
| 73 | Ga0466704_059474 | 3300042643 | Bacteria | 8080 |
| 74 | Ga0415639_026713 | 3300038395 | Bacteria | 6865 |
| 75 | Ga0466700_077650 | 3300042600 | Bacteria | 1278 |
| 76 | Ga0466720_159486 | 3300042607 | Bacteria | 1502 |
| 77 | JGI24695J34938_10059535 | 3300002450 | Bacteria | 1633 |
| 78 | Ga0072941_1144569 | 3300005201 | Bacteria | 4028 |
| 79 | Ga0466712_053113 | 3300042614 | Bacteria | 11639 |
| 80 | Ga0466712_090702 | 3300042614 | Bacteria | 15005 |
| 81 | Ga0466712_206744 | 3300042614 | Bacteria | 4863 |
| 82 | Ga0466712_236994 | 3300042614 | Unclassified | 2251 |
| 83 | Ga0466715_309831 | 3300042616 | Bacteria | 1557 |
| 84 | Ga0466715_345203 | 3300042616 | Bacteria | 7760 |
| 85 | Ga0466723_326899 | 3300042618 | Bacteria | 5743 |
| 86 | Ga0466705_122991 | 3300042612 | Unclassified | 3628 |
| 87 | Ga0466732_041243 | 3300042656 | Bacteria | 5736 |
| 88 | Ga0123356_10007516 | 3300010049 | Bacteria | 10864 |
| 89 | Ga0123353_11073698 | 3300010167 | Unclassified | 1072 |
| 90 | Ga0466731_057013 | 3300042622 | Bacteria | 49553 |
| 91 | Ga0466731_183486 | 3300042622 | Bacteria | 3923 |
| 92 | Ga0466696_123055 | 3300042596 | Bacteria | 16521 |
| 93 | Ga0466707_000975 | 3300042601 | Bacteria | 1103 |
| 94 | Ga0466707_200988 | 3300042601 | Bacteria | 7366 |
| 95 | Ga0466719_372001 | 3300042606 | Bacteria | 15055 |
| 96 | JGI24698J34947_10023252 | 3300002449 | Bacteria | 3317 |
| 97 | JGI24698J34947_10042266 | 3300002449 | Bacteria | 2343 |
| 98 | JGI24698J34947_10044798 | 3300002449 | Bacteria | 2262 |
| 99 | JGI24695J34938_10000090 | 3300002450 | Bacteria | 79670 |
| 100 | JGI24695J34938_10000341 | 3300002450 | Bacteria | 46027 |
| 101 | Ga0072940_1012279 | 3300005200 | Bacteria | 17174 |
| 102 | Ga0466712_001885 | 3300042614 | Bacteria | 9309 |
| 103 | Ga0466726_001787 | 3300042619 | Bacteria | 1873 |
| 104 | Ga0466726_494002 | 3300042619 | Unclassified | 1560 |
| 105 | Ga0466733_064703 | 3300042659 | Bacteria | 1631 |
| 106 | Ga0123355_11351557 | 3300009826 | Bacteria | 709 |
| 107 | Ga0123356_10076954 | 3300010049 | Bacteria | 3145 |
| 108 | Ga0123356_10271217 | 3300010049 | Bacteria | 1787 |
| 109 | Ga0466735_188905 | 3300042624 | Bacteria | 1019 |
| 110 | Ga0466702_060692 | 3300042635 | Bacteria | 1234 |
| 111 | Ga0466703_045349 | 3300042636 | Unclassified | 3365 |
| 112 | Ga0466692_004082 | 3300042591 | Bacteria | 1201 |
| 113 | Ga0466699_388666 | 3300042597 | Unclassified | 1669 |
| 114 | Ga0466707_047199 | 3300042601 | Unclassified | 2932 |
| 115 | Ga0466707_097853 | 3300042601 | Bacteria | 2467 |
| 116 | Ga0466707_334456 | 3300042601 | Bacteria | 1078 |
| 117 | Ga0466722_253337 | 3300042609 | Bacteria | 1520 |
| 118 | Ga0466698_248910 | 3300042610 | Bacteria | 3010 |
| 119 | AustNasuHG_c1015590 | 3300000089 | Bacteria | 2561 |
| 120 | JGI24698J34947_10000307 | 3300002449 | Bacteria | 21485 |
| 121 | JGI24698J34947_10003378 | 3300002449 | Bacteria | 8662 |
| 122 | JGI24698J34947_10004609 | 3300002449 | Bacteria | 7513 |
| 123 | JGI24698J34947_10023605 | 3300002449 | Unclassified | 3290 |
| 124 | JGI24698J34947_10056457 | 3300002449 | Bacteria | 1952 |
| 125 | JGI24695J34938_10000234 | 3300002450 | Bacteria | 52922 |
| 126 | Ga0072941_1000337 | 3300005201 | Bacteria | 38663 |
| 127 | Ga0466712_031932 | 3300042614 | Bacteria | 31317 |
| 128 | Ga0466712_032344 | 3300042614 | Bacteria | 20671 |
| 129 | Ga0466712_155391 | 3300042614 | Bacteria | 4723 |
| 130 | Ga0466715_625328 | 3300042616 | Bacteria | 3958 |
| 131 | Ga0466726_039827 | 3300042619 | Bacteria | 1833 |
| 132 | Ga0466705_336433 | 3300042612 | Unclassified | 4131 |
| 133 | Ga0123356_10025561 | 3300010049 | Bacteria | 5550 |
| 134 | Ga0123353_10081628 | 3300010167 | Bacteria | 5199 |
| 135 | Ga0123353_10217903 | 3300010167 | Bacteria | 2988 |
| 136 | Ga0466731_203709 | 3300042622 | Unclassified | 1020 |
| 137 | Ga0466735_131689 | 3300042624 | Bacteria | 1543 |
| 138 | Ga0466708_107238 | 3300042652 | Bacteria | 24038 |
| 139 | Ga0466727_104177 | 3300042655 | Bacteria | 1750 |
| 140 | Ga0415639_076684 | 3300038395 | Bacteria | 4913 |
| 141 | Ga0466696_090089 | 3300042596 | Bacteria | 1443 |
| 142 | Ga0466721_232641 | 3300042608 | Bacteria | 2670 |
| 143 | Ga0466722_036821 | 3300042609 | Bacteria | 1051 |
| 144 | AustNasuHG_c1004095 | 3300000089 | Bacteria | 5238 |
| 145 | Ga0466712_009954 | 3300042614 | Bacteria | 9507 |
| 146 | Ga0466712_289776 | 3300042614 | Bacteria | 27357 |
| 147 | Ga0466711_116093 | 3300042615 | Bacteria | 4264 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01195 | Pept_tRNA_hydro | Peptidyl-tRNA hydrolase | 41 | 221 | 0.92 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01195 | GO:0004045 | aminoacyl-tRNA hydrolase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.