Protein Family IF04997
Metagenome
Isolate
121
Members
34
Samples
113
Scaffolds
147.18
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_115907|Ga0466694_115907_2053_2493
- Length
- 146 aa
- Sequence
- MASRRKSRILAFQALYFWESNRVPVEELINFAWLDEEKLKSLNEEAVFSRMLTAGAIENIEVIDKMIKEHLENWDITRLNRVDLAVLRLSVYTLMFQTDISSSIAIEEAIGICIEFGTDDSYKFVNGVLDSIRITLQKNPITQNAI
Sample Types
Isolate
6.6%
Metagenome
93.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
61.3%
Unclassified
25.8%
Kalotermitidae
6.5%
Rhinotermitidae
3.2%
Termopsidae
3.2%
Taxonomy
Archaea
1
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 2 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 3 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 6 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 7 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 10 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 11 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 12 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 13 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 14 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 15 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 16 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 17 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 31 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 34 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10001455 | 3300010049 | Bacteria | 26164 |
| 2 | Ga0466693_205117 | 3300042592 | Bacteria | 3307 |
| 3 | Ga0466694_003493 | 3300042594 | Bacteria | 74539 |
| 4 | Ga0466699_251864 | 3300042597 | Bacteria | 59491 |
| 5 | Ga0466699_262811 | 3300042597 | Bacteria | 12165 |
| 6 | JGI24698J34947_10018642 | 3300002449 | Bacteria | 3748 |
| 7 | Ga0466717_161206 | 3300042604 | Bacteria | 1188 |
| 8 | Ga0466712_155783 | 3300042614 | Bacteria | 3892 |
| 9 | Ga0466712_214902 | 3300042614 | Bacteria | 6079 |
| 10 | Ga0415639_009531 | 3300038395 | Bacteria | 1043 |
| 11 | Ga0466694_115907 | 3300042594 | Bacteria | 6037 |
| 12 | AustNasuHG_c1008805 | 3300000089 | Bacteria | 3570 |
| 13 | JGI24695J34938_10041182 | 3300002450 | Bacteria | 2075 |
| 14 | Ga0072941_1005546 | 3300005201 | Bacteria | 12820 |
| 15 | Ga0072941_1128345 | 3300005201 | Bacteria | 4107 |
| 16 | Ga0072941_1263349 | 3300005201 | Bacteria | 1570 |
| 17 | Ga0466731_006925 | 3300042622 | Bacteria | 2462 |
| 18 | Ga0466712_234202 | 3300042614 | Bacteria | 4736 |
| 19 | Ga0415639_009521 | 3300038395 | Bacteria | 3452 |
| 20 | AustNasuHG_c1002857 | 3300000089 | Bacteria | 6234 |
| 21 | AustNasuHG_c1013609 | 3300000089 | Bacteria | 2787 |
| 22 | JGI24698J34947_10005606 | 3300002449 | Bacteria | 6883 |
| 23 | JGI24698J34947_10023083 | 3300002449 | Unclassified | 3329 |
| 24 | JGI24698J34947_10035310 | 3300002449 | Bacteria | 2611 |
| 25 | JGI24698J34947_10052757 | 3300002449 | Unclassified | 2039 |
| 26 | JGI24695J34938_10000245 | 3300002450 | Bacteria | 52223 |
| 27 | JGI24695J34938_10006197 | 3300002450 | Bacteria | 7264 |
| 28 | JGI24695J34938_10007722 | 3300002450 | Bacteria | 6236 |
| 29 | Ga0466720_238863 | 3300042607 | Bacteria | 49455 |
| 30 | Ga0466718_015450 | 3300042617 | Bacteria | 2823 |
| 31 | Ga0264413_114200 | 3300024493 | Bacteria | 2764 |
| 32 | Ga0466694_105932 | 3300042594 | Bacteria | 49364 |
| 33 | Ga0466699_026265 | 3300042597 | Bacteria | 8508 |
| 34 | Ga0466699_313922 | 3300042597 | Bacteria | 2346 |
| 35 | JGI24698J34947_10017293 | 3300002449 | Bacteria | 3909 |
| 36 | JGI24695J34938_10000063 | 3300002450 | Bacteria | 87942 |
| 37 | JGI24695J34938_10000186 | 3300002450 | Bacteria | 58319 |
| 38 | JGI24695J34938_10000362 | 3300002450 | Bacteria | 44977 |
| 39 | JGI24695J34938_10073362 | 3300002450 | Bacteria | 1425 |
| 40 | Ga0466731_351699 | 3300042622 | Bacteria | 1519 |
| 41 | Ga0466720_033383 | 3300042607 | Bacteria | 5887 |
| 42 | Ga0466712_188542 | 3300042614 | Bacteria | 16024 |
| 43 | Ga0466718_022590 | 3300042617 | Unclassified | 1987 |
| 44 | Ga0466718_022677 | 3300042617 | Unclassified | 3371 |
| 45 | Ga0466699_049958 | 3300042597 | Bacteria | 8272 |
| 46 | Ga0466699_147610 | 3300042597 | Bacteria | 7598 |
| 47 | Ga0466699_293078 | 3300042597 | Bacteria | 6813 |
| 48 | FAAS_10002113 | 3300001880 | Bacteria | 825 |
| 49 | JGI24695J34938_10000352 | 3300002450 | Bacteria | 45395 |
| 50 | JGI24695J34938_10000448 | 3300002450 | Bacteria | 39903 |
| 51 | JGI24695J34938_10297680 | 3300002450 | Bacteria | 696 |
| 52 | JGI24699J35502_10881558 | 3300002509 | Archaea | 1009 |
| 53 | Ga0072940_1005236 | 3300005200 | Bacteria | 2286 |
| 54 | Ga0072940_1297194 | 3300005200 | Bacteria | 2450 |
| 55 | Ga0072941_1054449 | 3300005201 | Bacteria | 7590 |
| 56 | Ga0074263_111957 | 3300005485 | Unclassified | 2126 |
| 57 | Ga0074263_114981 | 3300005485 | Bacteria | 1909 |
| 58 | Ga0466731_411349 | 3300042622 | Bacteria | 1424 |
| 59 | Ga0466712_248869 | 3300042614 | Bacteria | 12500 |
| 60 | Ga0466718_084663 | 3300042617 | Unclassified | 4570 |
| 61 | Ga0466718_096495 | 3300042617 | Bacteria | 5003 |
| 62 | Ga0466732_393353 | 3300042656 | Bacteria | 1402 |
| 63 | Ga0123356_10042661 | 3300010049 | Bacteria | 4224 |
| 64 | Ga0415639_101780 | 3300038395 | Bacteria | 5710 |
| 65 | Ga0466690_026064 | 3300042590 | Bacteria | 1558 |
| 66 | Ga0466694_009123 | 3300042594 | Bacteria | 47055 |
| 67 | Ga0466694_100008 | 3300042594 | Bacteria | 14970 |
| 68 | JGI24695J34938_10000387 | 3300002450 | Bacteria | 43538 |
| 69 | Ga0072941_1020396 | 3300005201 | Bacteria | 6009 |
| 70 | Ga0072941_1185642 | 3300005201 | Unclassified | 3237 |
| 71 | Ga0466731_260018 | 3300042622 | Bacteria | 3816 |
| 72 | Ga0466712_062108 | 3300042614 | Bacteria | 13521 |
| 73 | Ga0466712_109093 | 3300042614 | Bacteria | 8036 |
| 74 | Ga0466712_171138 | 3300042614 | Bacteria | 31265 |
| 75 | Ga0123356_11401440 | 3300010049 | Bacteria | 859 |
| 76 | Ga0264413_114199 | 3300024493 | Bacteria | 3132 |
| 77 | Ga0466699_143042 | 3300042597 | Bacteria | 1960 |
| 78 | Ga0466699_289291 | 3300042597 | Bacteria | 6813 |
| 79 | AustNasuHG_c1007668 | 3300000089 | Bacteria | 3828 |
| 80 | AustNasuHG_c1038380 | 3300000089 | Bacteria | 1207 |
| 81 | JGI24698J34947_10042734 | 3300002449 | Bacteria | 2327 |
| 82 | JGI24698J34947_10217662 | 3300002449 | Bacteria | 735 |
| 83 | JGI24695J34938_10000601 | 3300002450 | Bacteria | 34636 |
| 84 | JGI24695J34938_10004860 | 3300002450 | Bacteria | 8616 |
| 85 | JGI24695J34938_10005867 | 3300002450 | Bacteria | 7548 |
| 86 | JGI24695J34938_10012152 | 3300002450 | Bacteria | 4584 |
| 87 | JGI24695J34938_10054585 | 3300002450 | Bacteria | 1731 |
| 88 | Ga0072941_1236020 | 3300005201 | Bacteria | 653 |
| 89 | Ga0466720_047996 | 3300042607 | Bacteria | 4010 |
| 90 | Ga0466721_242624 | 3300042608 | Bacteria | 64943 |
| 91 | Ga0466722_193982 | 3300042609 | Bacteria | 3808 |
| 92 | Ga0466712_178459 | 3300042614 | Bacteria | 1250 |
| 93 | Ga0466718_033288 | 3300042617 | Bacteria | 2165 |
| 94 | Ga0466718_053356 | 3300042617 | Bacteria | 6161 |
| 95 | Ga0123356_11025641 | 3300010049 | Bacteria | 995 |
| 96 | Ga0264413_141086 | 3300024493 | Bacteria | 4860 |
| 97 | Ga0415639_009530 | 3300038395 | Bacteria | 2341 |
| 98 | Ga0466699_209260 | 3300042597 | Bacteria | 2222 |
| 99 | Ga0466699_366516 | 3300042597 | Bacteria | 3099 |
| 100 | JGI24695J34938_10000315 | 3300002450 | Bacteria | 47627 |
| 101 | JGI24695J34938_10003861 | 3300002450 | Bacteria | 10158 |
| 102 | JGI24695J34938_10004242 | 3300002450 | Bacteria | 9508 |
| 103 | JGI24699J35502_10901994 | 3300002509 | Unclassified | 1051 |
| 104 | Ga0072940_1021948 | 3300005200 | Bacteria | 5995 |
| 105 | Ga0072941_1007440 | 3300005201 | Bacteria | 11162 |
| 106 | Ga0466731_281972 | 3300042622 | Bacteria | 3132 |
| 107 | Ga0466702_429693 | 3300042635 | Bacteria | 19447 |
| 108 | Ga0466720_238860 | 3300042607 | Bacteria | 102895 |
| 109 | Ga0466712_065702 | 3300042614 | Bacteria | 1270 |
| 110 | Ga0466712_147400 | 3300042614 | Bacteria | 11965 |
| 111 | Ga0466718_058214 | 3300042617 | Bacteria | 17139 |
| 112 | Ga0466726_140021 | 3300042619 | Bacteria | 14064 |
| 113 | Ga0466728_000967 | 3300042620 | Bacteria | 2153 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01029 | NusB | NusB family | 5 | 132 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.