Protein Family IF04983
Metagenome
Isolate
106
Members
34
Samples
98
Scaffolds
204.95
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_081480|Ga0466694_081480_3470_4189
- Length
- 239 aa
- Sequence
- VFFEGRVLHYHLENYLQCGIYYIIRKKFYTFIQEYDVSRYCRKVKIFSALEVANVCGVVNQTAINWIKSGHLKAFTTPGGQYRVYAKDLAAFLDKRGMADSGEALNVFLEKADWYTLLAAAGDQALGNRIKEELENTLLDHEVLLASDGFELGRILAETKPGFIIIDMAFPGVDHSRLIRTLKEDLSFGKPFVFIMNQPDSAEAPPNSDGVFSLPEEINRLAESIRSMEKQAEPVQNIG
Sample Types
Isolate
7.5%
Metagenome
92.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
75.8%
Unclassified
24.2%
Taxonomy
Archaea
0
Bacteria
103
Eukaryota
0
Viruses
1
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 6 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 7 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 11 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 20 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 21 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 22 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 23 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 24 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 27 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 31 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10058620 | 3300009784 | Bacteria | 5169 |
| 2 | Ga0123356_10395094 | 3300010049 | Bacteria | 1519 |
| 3 | Ga0123356_10461927 | 3300010049 | Bacteria | 1419 |
| 4 | Ga0123353_10098250 | 3300010167 | Bacteria | 4718 |
| 5 | Ga0123353_10103458 | 3300010167 | Bacteria | 4590 |
| 6 | Ga0123353_10254285 | 3300010167 | Bacteria | 2718 |
| 7 | Ga0123353_10475783 | 3300010167 | Bacteria | 1829 |
| 8 | Ga0123353_11257674 | 3300010167 | Bacteria | 965 |
| 9 | Ga0123354_10255159 | 3300010882 | Bacteria | 1766 |
| 10 | AustNasuHG_c1002095 | 3300000089 | Bacteria | 7212 |
| 11 | JGI24698J34947_10052710 | 3300002449 | Bacteria | 2040 |
| 12 | Ga0466694_181702 | 3300042594 | Bacteria | 1023 |
| 13 | Ga0466694_395112 | 3300042594 | Bacteria | 3062 |
| 14 | Ga0466699_330035 | 3300042597 | Bacteria | 1178 |
| 15 | Ga0466701_077851 | 3300042598 | Bacteria | 1062 |
| 16 | Ga0466717_065440 | 3300042604 | Bacteria | 1064 |
| 17 | Ga0466712_109402 | 3300042614 | Bacteria | 9771 |
| 18 | Ga0123357_10028267 | 3300009784 | Bacteria | 7587 |
| 19 | Ga0123356_10692402 | 3300010049 | Bacteria | 1188 |
| 20 | Ga0123353_10085743 | 3300010167 | Bacteria | 5072 |
| 21 | Ga0123353_10391375 | 3300010167 | Bacteria | 2073 |
| 22 | Ga0123354_10378609 | 3300010882 | Bacteria | 1225 |
| 23 | JGI24698J34947_10013138 | 3300002449 | Bacteria | 4525 |
| 24 | JGI24702J35022_10072272 | 3300002462 | Bacteria | 1860 |
| 25 | JGI24702J35022_10142759 | 3300002462 | Bacteria | 1337 |
| 26 | Ga0466698_250309 | 3300042610 | Bacteria | 2016 |
| 27 | Ga0466712_108541 | 3300042614 | Bacteria | 1746 |
| 28 | Ga0466732_195011 | 3300042656 | Bacteria | 2597 |
| 29 | Ga0123357_10430630 | 3300009784 | Bacteria | 1166 |
| 30 | Ga0123353_10136594 | 3300010167 | Bacteria | 3932 |
| 31 | Ga0123353_10188823 | 3300010167 | Bacteria | 3255 |
| 32 | Ga0123353_10602228 | 3300010167 | Bacteria | 1570 |
| 33 | JGI24702J35022_10016012 | 3300002462 | Bacteria | 4118 |
| 34 | Ga0466693_108035 | 3300042592 | Bacteria | 17327 |
| 35 | Ga0466693_416794 | 3300042592 | Bacteria | 1165 |
| 36 | Ga0466694_170642 | 3300042594 | Bacteria | 4303 |
| 37 | Ga0466695_038082 | 3300042595 | Bacteria | 6826 |
| 38 | Ga0466699_107545 | 3300042597 | Bacteria | 1270 |
| 39 | Ga0466732_283684 | 3300042656 | Bacteria | 2140 |
| 40 | Ga0123357_10014714 | 3300009784 | Bacteria | 10225 |
| 41 | Ga0123355_10945264 | 3300009826 | Bacteria | 927 |
| 42 | Ga0123353_10157720 | 3300010167 | Bacteria | 3615 |
| 43 | Ga0123353_10558007 | 3300010167 | Bacteria | 1650 |
| 44 | Ga0123353_10612493 | 3300010167 | Bacteria | 1553 |
| 45 | Ga0123353_10908985 | 3300010167 | Bacteria | 1197 |
| 46 | JGI24698J34947_10021753 | 3300002449 | Bacteria | 3446 |
| 47 | JGI24698J34947_10037976 | 3300002449 | Bacteria | 2499 |
| 48 | JGI24695J34938_10018787 | 3300002450 | Bacteria | 3444 |
| 49 | JGI24702J35022_10072031 | 3300002462 | Bacteria | 1862 |
| 50 | Ga0466720_221247 | 3300042607 | Bacteria | 2200 |
| 51 | Ga0466712_000556 | 3300042614 | Bacteria | 1288 |
| 52 | Ga0466718_165655 | 3300042617 | Bacteria | 1160 |
| 53 | Ga0123353_10236546 | 3300010167 | Bacteria | 2842 |
| 54 | Ga0123353_10336018 | 3300010167 | Bacteria | 2284 |
| 55 | Ga0123353_10424467 | 3300010167 | Bacteria | 1969 |
| 56 | JGI24698J34947_10175466 | 3300002449 | Bacteria | 862 |
| 57 | JGI24695J34938_10162020 | 3300002450 | Bacteria | 920 |
| 58 | Ga0264413_112002 | 3300024493 | Bacteria | 8408 |
| 59 | Ga0466694_338224 | 3300042594 | Bacteria | 1776 |
| 60 | Ga0466695_050976 | 3300042595 | Bacteria | 1076 |
| 61 | Ga0466698_072858 | 3300042610 | Bacteria | 1179 |
| 62 | Ga0466698_148409 | 3300042610 | Bacteria | 1115 |
| 63 | Ga0466712_121774 | 3300042614 | Bacteria | 10840 |
| 64 | Ga0123357_10117348 | 3300009784 | Bacteria | 3367 |
| 65 | Ga0123357_10154835 | 3300009784 | Bacteria | 2768 |
| 66 | Ga0123356_11171359 | 3300010049 | Bacteria | 935 |
| 67 | JGI24698J34947_10006435 | 3300002449 | Bacteria | 6446 |
| 68 | JGI24698J34947_10138220 | 3300002449 | Bacteria | 1030 |
| 69 | JGI24698J34947_10238348 | 3300002449 | Bacteria | 687 |
| 70 | JGI24695J34938_10024425 | 3300002450 | Bacteria | 2903 |
| 71 | JGI24695J34938_10080174 | 3300002450 | Bacteria | 1349 |
| 72 | JGI24702J35022_10001048 | 3300002462 | Bacteria | 17293 |
| 73 | JGI24702J35022_10052958 | 3300002462 | Bacteria | 2164 |
| 74 | JGI24702J35022_10062380 | 3300002462 | Bacteria | 1996 |
| 75 | JGI24705J35276_12155162 | 3300002504 | Bacteria | 1203 |
| 76 | Ga0415639_098783 | 3300038395 | Unclassified | 1277 |
| 77 | Ga0123357_10174504 | 3300009784 | Bacteria | 2532 |
| 78 | Ga0123357_10186115 | 3300009784 | Bacteria | 2409 |
| 79 | Ga0123356_11455402 | 3300010049 | Bacteria | 844 |
| 80 | Ga0123353_10029924 | 3300010167 | Bacteria | 8402 |
| 81 | Ga0123353_11039600 | 3300010167 | Bacteria | 1095 |
| 82 | Ga0123353_11267134 | 3300010167 | Unclassified | 960 |
| 83 | JGI24702J35022_10006107 | 3300002462 | Bacteria | 6992 |
| 84 | JGI24705J35276_12185923 | 3300002504 | Bacteria | 1415 |
| 85 | JGI24705J35276_12213573 | 3300002504 | Bacteria | 1929 |
| 86 | Ga0466731_271527 | 3300042622 | Bacteria | 1172 |
| 87 | Ga0466702_016029 | 3300042635 | Bacteria | 1001 |
| 88 | Ga0466712_244254 | 3300042614 | Bacteria | 12562 |
| 89 | Ga0466732_207002 | 3300042656 | Bacteria | 2842 |
| 90 | Ga0123353_10040505 | 3300010167 | Bacteria | 7351 |
| 91 | Ga0123353_10052640 | 3300010167 | Bacteria | 6502 |
| 92 | Ga0123353_11001587 | 3300010167 | Bacteria | 1123 |
| 93 | JGI24698J34947_10003018 | 3300002449 | Bacteria | 9122 |
| 94 | Ga0415639_118169 | 3300038395 | Bacteria | 1861 |
| 95 | Ga0466694_081480 | 3300042594 | Bacteria | 6120 |
| 96 | Ga0466700_003435 | 3300042600 | Bacteria | 2585 |
| 97 | Ga0466700_299636 | 3300042600 | Viruses | 2317 |
| 98 | Ga0466698_509064 | 3300042610 | Bacteria | 1071 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF12728 | HTH_17 | Helix-turn-helix domain | 51 | 96 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.