Protein Family IF04972

Metagenome Isolate
167 Members
45 Samples
149 Scaffolds
395.84 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_056716|Ga0466694_056716_743_2020
Length
425 aa
Sequence
MIRKMFEEGNLLKKQHGADKVFDFSLGNPDLDPPPDFHRVLLKLAEEDAQGSHGYMPNAGFPAVREALARKASREHQVSIDGSHIVMTVGAAGGLNAVFKTICDPGDEVIVTRPYFMEYRSYTGNHGAKLIEVDSLPDFNMNIDAIDAALTPQTAAVLINSPNNPTGKIYPAQSIAALAGLLYRHGEKTGRLPYLVSDEPYREIAYNVEVPPVLRAYSESIVVNSYSKSLSLPGERIGYIAVSPDIADRADVMNGLIYATRILGYVNAPALMQRIVAELTEAVVDIAVYARRRDAFTAILDEAGIEYAVPEGAFYLFCKVPPRRNGETGDDCMRGVHTPPFRALKKGMDPETKRTFSPTLPKQHTPSLQGGVVDLAFVDHLKQHLILGVPGAGFGKPGWLRFAYCVDEKIIRAAAASFNKAMESW

📊 Sample Types

Isolate 10.8%
Metagenome 89.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.2%
Unclassified 41.9%
Rhinotermitidae 4.7%
Kalotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 150
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
2 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
7 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
8 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
9 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
13 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
24 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
25 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
29 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
30 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
31 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
32 2820093073 Unclassified Proteobacteria Lab288P3bin233 Isolate Unclassified
33 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
34 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
35 2820082748 Unclassified Proteobacteria Lab288P4bin14 Isolate Unclassified
36 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
37 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
38 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
39 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
40 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
41 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
42 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
43 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
44 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
45 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10017101 3300010049 Bacteria 6903
2 Ga0123356_10117684 3300010049 Bacteria 2579
3 Ga0123356_10139184 3300010049 Bacteria 2392
4 Ga0466720_036061 3300042607 Bacteria 5163
5 Ga0466720_190082 3300042607 Bacteria 4511
6 Ga0466720_211594 3300042607 Bacteria 3412
7 Ga0466720_236486 3300042607 Bacteria 5893
8 Ga0466712_268320 3300042614 Bacteria 16912
9 JGI24698J34947_10001486 3300002449 Bacteria 12382
10 JGI24698J34947_10009596 3300002449 Unclassified 5304
11 JGI24698J34947_10018090 3300002449 Bacteria 3813
12 JGI24695J34938_10000091 3300002450 Bacteria 79625
13 Ga0072941_1025050 3300005201 Bacteria 5321
14 Ga0072941_1077335 3300005201 Bacteria 2716
15 Ga0074263_113414 3300005485 Bacteria 4804
16 Ga0466692_143620 3300042591 Bacteria 2505
17 Ga0466694_332265 3300042594 Bacteria 4511
18 Ga0466699_119986 3300042597 Bacteria 28218
19 Ga0466731_204697 3300042622 Unclassified 36475
20 Ga0466708_389739 3300042652 Bacteria 4532
21 Ga0123356_10000007 3300010049 Bacteria 240704
22 Ga0123356_10009166 3300010049 Bacteria 9789
23 Ga0123356_10246237 3300010049 Bacteria 1862
24 Ga0466720_173450 3300042607 Bacteria 3833
25 Ga0466712_008971 3300042614 Bacteria 46922
26 Ga0466712_041916 3300042614 Bacteria 16385
27 Ga0466712_186271 3300042614 Unclassified 2243
28 Ga0466718_094582 3300042617 Bacteria 3047
29 Ga0466718_103954 3300042617 Bacteria 4486
30 JGI24698J34947_10001391 3300002449 Bacteria 12720
31 JGI24698J34947_10009894 3300002449 Bacteria 5229
32 JGI24698J34947_10027865 3300002449 Bacteria 2996
33 JGI24702J35022_10022504 3300002462 Bacteria 3411
34 JGI24699J35502_11127581 3300002509 Bacteria 4186
35 Ga0072941_1017849 3300005201 Bacteria 7172
36 Ga0072941_1022120 3300005201 Bacteria 30539
37 Ga0466699_241717 3300042597 Bacteria 12231
38 Ga0123356_10000032 3300010049 Bacteria 154381
39 Ga0123353_10062603 3300010167 Bacteria 5966
40 Ga0466720_197641 3300042607 Bacteria 23703
41 Ga0466712_127471 3300042614 Bacteria 12440
42 Ga0466712_241817 3300042614 Bacteria 15689
43 AustNasuHG_c1000182 3300000089 Bacteria 20554
44 JGI24698J34947_10001864 3300002449 Bacteria 11256
45 JGI24698J34947_10002909 3300002449 Bacteria 9286
46 JGI24698J34947_10036458 3300002449 Bacteria 2560
47 JGI24695J34938_10000063 3300002450 Bacteria 87942
48 JGI24695J34938_10001439 3300002450 Bacteria 20164
49 JGI24695J34938_10004576 3300002450 Unclassified 9012
50 Ga0264413_101847 3300024493 Bacteria 86591
51 Ga0415639_015547 3300038395 Bacteria 22627
52 Ga0466694_056716 3300042594 Bacteria 3511
53 Ga0466699_018113 3300042597 Bacteria 33087
54 Ga0466699_056757 3300042597 Bacteria 12083
55 Ga0123356_10017233 3300010049 Bacteria 6874
56 Ga0466700_161834 3300042600 Bacteria 2042
57 Ga0466720_012093 3300042607 Bacteria 12751
58 Ga0466720_061587 3300042607 Bacteria 12424
59 Ga0466698_119516 3300042610 Bacteria 1532
60 Ga0466712_150799 3300042614 Unclassified 3558
61 Ga0466712_215923 3300042614 Unclassified 4435
62 AustNasuHG_c1010754 3300000089 Bacteria 3182
63 JGI24698J34947_10004816 3300002449 Bacteria 7383
64 JGI24695J34938_10000016 3300002450 Bacteria 116336
65 JGI24695J34938_10004202 3300002450 Bacteria 9575
66 JGI24695J34938_10006344 3300002450 Bacteria 7140
67 Ga0072941_1016308 3300005201 Bacteria 18525
68 Ga0466694_107812 3300042594 Bacteria 14039
69 Ga0466699_270452 3300042597 Bacteria 1419
70 Ga0466699_274814 3300042597 Bacteria 12079
71 Ga0466699_328510 3300042597 Bacteria 3174
72 Ga0466699_379790 3300042597 Bacteria 11093
73 Ga0466702_435230 3300042635 Bacteria 11005
74 Ga0466732_038698 3300042656 Bacteria 20157
75 Ga0466732_133410 3300042656 Bacteria 9219
76 Ga0466720_094521 3300042607 Bacteria 10872
77 Ga0466720_101587 3300042607 Bacteria 22940
78 Ga0466720_168388 3300042607 Bacteria 12920
79 Ga0466712_304614 3300042614 Unclassified 1419
80 Ga0466718_012443 3300042617 Bacteria 1553
81 AustNasuHG_c1017486 3300000089 Bacteria 2384
82 JGI24698J34947_10016711 3300002449 Bacteria 3981
83 Ga0264413_101833 3300024493 Bacteria 5299
84 Ga0264413_117303 3300024493 Unclassified 2933
85 Ga0264413_120146 3300024493 Bacteria 2676
86 Ga0466694_066267 3300042594 Bacteria 5763
87 Ga0466699_195571 3300042597 Bacteria 31724
88 Ga0123356_10016465 3300010049 Bacteria 7052
89 Ga0123353_10000013 3300010167 Bacteria 213494
90 Ga0466720_015661 3300042607 Bacteria 37367
91 Ga0466720_090123 3300042607 Bacteria 11250
92 Ga0466721_242624 3300042608 Bacteria 64943
93 Ga0466722_067849 3300042609 Bacteria 9100
94 Ga0466712_043266 3300042614 Bacteria 2300
95 Ga0466712_118083 3300042614 Bacteria 55745
96 Ga0466712_320023 3300042614 Unclassified 3020
97 Ga0466718_006904 3300042617 Bacteria 3351
98 Ga0466718_097036 3300042617 Bacteria 3889
99 JGI24698J34947_10000867 3300002449 Bacteria 15257
100 JGI24698J34947_10020493 3300002449 Bacteria 3560
101 JGI24698J34947_10040257 3300002449 Bacteria 2414
102 JGI24698J34947_10058755 3300002449 Bacteria 1903
103 JGI24695J34938_10018548 3300002450 Bacteria 3473
104 Ga0072940_1010827 3300005200 Bacteria 8766
105 Ga0074263_114124 3300005485 Unclassified 4021
106 Ga0466693_246237 3300042592 Bacteria 3067
107 Ga0466694_077871 3300042594 Bacteria 71235
108 Ga0466699_185999 3300042597 Bacteria 1995
109 Ga0466699_258762 3300042597 Bacteria 52150
110 Ga0466702_264534 3300042635 Bacteria 1985
111 Ga0123356_10075969 3300010049 Unclassified 3165
112 Ga0466700_219811 3300042600 Bacteria 5114
113 Ga0466720_061861 3300042607 Bacteria 2086
114 Ga0466720_081062 3300042607 Bacteria 39537
115 Ga0466722_131232 3300042609 Bacteria 1969
116 Ga0466712_196007 3300042614 Unclassified 8152
117 Ga0466712_226564 3300042614 Bacteria 10213
118 Ga0466718_045411 3300042617 Bacteria 2647
119 Ga0466718_071437 3300042617 Bacteria 18319
120 Ga0466718_080825 3300042617 Bacteria 36449
121 Ga0466718_109195 3300042617 Bacteria 5051
122 JGI24698J34947_10012471 3300002449 Bacteria 4659
123 JGI24698J34947_10023709 3300002449 Bacteria 3282
124 JGI24698J34947_10031118 3300002449 Unclassified 2811
125 JGI24698J34947_10077956 3300002449 Unclassified 1565
126 Ga0264413_117302 3300024493 Bacteria 4538
127 Ga0415639_184131 3300038395 Bacteria 3764
128 Ga0466692_038496 3300042591 Bacteria 1895
129 Ga0466692_125885 3300042591 Bacteria 4477
130 Ga0466694_055890 3300042594 Bacteria 16001
131 Ga0466694_279290 3300042594 Bacteria 4649
132 Ga0466699_036574 3300042597 Bacteria 5450
133 Ga0466699_212922 3300042597 Bacteria 4504
134 Ga0466702_440774 3300042635 Bacteria 6474
135 Ga0466732_409124 3300042656 Bacteria 27790
136 Ga0466720_034483 3300042607 Bacteria 3415
137 Ga0466720_142103 3300042607 Unclassified 1419
138 Ga0466720_147873 3300042607 Bacteria 6065
139 Ga0466712_085501 3300042614 Unclassified 2999
140 Ga0466712_247728 3300042614 Unclassified 2969
141 Ga0466712_276159 3300042614 Bacteria 2644
142 Ga0466718_028675 3300042617 Bacteria 19150
143 JGI24698J34947_10004069 3300002449 Bacteria 7942
144 JGI24698J34947_10006050 3300002449 Bacteria 6645
145 JGI24698J34947_10022560 3300002449 Bacteria 3375
146 JGI24702J35022_10035432 3300002462 Bacteria 2669
147 Ga0466692_049471 3300042591 Bacteria 5375
148 Ga0466699_041586 3300042597 Bacteria 2399
149 Ga0466699_256832 3300042597 Bacteria 12735

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00155 Aminotran_1_2 Aminotransferase class I and II 20 416 0.92

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.