Protein Family IF04956
Metagenome
122
Members
28
Samples
122
Scaffolds
221.05
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_220441|Ga0466691_220441_1081_1866
- Length
- 250 aa
- Sequence
- VPQKVSGASHFFQGRPRLDVIHKKVYYNKGKNSQERRRKMAHNDWIPGREQDLVDLAQKWAVVLADQTKIAAFGWDGTEVTAVLGSISAFLTARNAYETDNSTAKRLAMRDFANSAVRFNKKMDDPAKLVMGIHPKDTAPTTHGTPTNQPDTVVENSVNHFEHKVKALNHETGDTSKPVDAYGVRYAWQVGGTKPVSGADLPKTKFSRKTTHIVTHTEADKGKPAYYATCYENGKGDTGPWSPVEEAFIG
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
51.9%
Termitidae
22.2%
Rhinotermitidae
11.1%
Termopsidae
11.1%
Unclassified
3.7%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 6 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_010056 | 3300042659 | Bacteria | 20477 |
| 2 | Ga0466690_019664 | 3300042590 | Bacteria | 8013 |
| 3 | Ga0466690_267173 | 3300042590 | Bacteria | 1919 |
| 4 | Ga0466692_032461 | 3300042591 | Unclassified | 2020 |
| 5 | Ga0466696_338555 | 3300042596 | Bacteria | 12099 |
| 6 | Ga0466699_424471 | 3300042597 | Bacteria | 1090 |
| 7 | Ga0466723_033794 | 3300042618 | Bacteria | 16212 |
| 8 | Ga0466716_082598 | 3300042605 | Bacteria | 3263 |
| 9 | Ga0466722_163820 | 3300042609 | Bacteria | 9719 |
| 10 | Ga0466722_215997 | 3300042609 | Bacteria | 3067 |
| 11 | JGI24698J34947_10050352 | 3300002449 | Bacteria | 2102 |
| 12 | Ga0466733_203386 | 3300042659 | Bacteria | 4274 |
| 13 | Ga0466703_036956 | 3300042636 | Bacteria | 4748 |
| 14 | Ga0265387_1000548 | 3300024582 | Bacteria | 5923 |
| 15 | Ga0466690_328757 | 3300042590 | Bacteria | 2205 |
| 16 | Ga0466692_078639 | 3300042591 | Bacteria | 28934 |
| 17 | Ga0466691_055161 | 3300042593 | Bacteria | 6475 |
| 18 | Ga0466691_122086 | 3300042593 | Bacteria | 5289 |
| 19 | Ga0466699_182042 | 3300042597 | Bacteria | 1280 |
| 20 | Ga0466705_464865 | 3300042612 | Bacteria | 1024 |
| 21 | Ga0466715_051491 | 3300042616 | Bacteria | 4534 |
| 22 | Ga0466715_091431 | 3300042616 | Bacteria | 4434 |
| 23 | Ga0466723_004542 | 3300042618 | Bacteria | 5385 |
| 24 | Ga0466723_277300 | 3300042618 | Bacteria | 6729 |
| 25 | Ga0466723_296037 | 3300042618 | Bacteria | 28470 |
| 26 | Ga0466726_172842 | 3300042619 | Bacteria | 4295 |
| 27 | Ga0466726_269787 | 3300042619 | Bacteria | 1831 |
| 28 | Ga0466707_042234 | 3300042601 | Bacteria | 7401 |
| 29 | Ga0466707_086689 | 3300042601 | Bacteria | 5240 |
| 30 | Ga0466716_063124 | 3300042605 | Bacteria | 2150 |
| 31 | Ga0466719_430886 | 3300042606 | Bacteria | 1113 |
| 32 | Ga0466703_415716 | 3300042636 | Bacteria | 13055 |
| 33 | Ga0466704_054401 | 3300042643 | Bacteria | 1122 |
| 34 | Ga0466708_022445 | 3300042652 | Bacteria | 2911 |
| 35 | Ga0466727_190800 | 3300042655 | Bacteria | 1601 |
| 36 | Ga0466692_015105 | 3300042591 | Bacteria | 3013 |
| 37 | Ga0466691_006485 | 3300042593 | Bacteria | 33041 |
| 38 | Ga0466696_348225 | 3300042596 | Bacteria | 4385 |
| 39 | Ga0466729_004069 | 3300042621 | Bacteria | 1996 |
| 40 | Ga0466719_343261 | 3300042606 | Bacteria | 2713 |
| 41 | Ga0466722_030489 | 3300042609 | Unclassified | 3538 |
| 42 | Ga0466722_030740 | 3300042609 | Bacteria | 2807 |
| 43 | Ga0466722_161001 | 3300042609 | Bacteria | 1462 |
| 44 | Ga0068302_10013718 | 3300005071 | Unclassified | 1006 |
| 45 | Ga0466704_122724 | 3300042643 | Bacteria | 19891 |
| 46 | Ga0466709_020534 | 3300042648 | Bacteria | 2913 |
| 47 | Ga0466708_393782 | 3300042652 | Bacteria | 3515 |
| 48 | Ga0466690_098831 | 3300042590 | Unclassified | 5811 |
| 49 | Ga0466712_255712 | 3300042614 | Bacteria | 1056 |
| 50 | Ga0466723_264598 | 3300042618 | Bacteria | 4745 |
| 51 | Ga0466728_153055 | 3300042620 | Bacteria | 2375 |
| 52 | Ga0466707_133570 | 3300042601 | Bacteria | 25416 |
| 53 | Ga0466716_273386 | 3300042605 | Bacteria | 5551 |
| 54 | Ga0466722_073868 | 3300042609 | Bacteria | 2393 |
| 55 | JGI24698J34947_10043309 | 3300002449 | Unclassified | 2308 |
| 56 | Ga0466733_023530 | 3300042659 | Bacteria | 2288 |
| 57 | Ga0466708_178294 | 3300042652 | Bacteria | 2997 |
| 58 | Ga0466690_022294 | 3300042590 | Unclassified | 3703 |
| 59 | Ga0466690_022848 | 3300042590 | Bacteria | 1601 |
| 60 | Ga0466690_133585 | 3300042590 | Bacteria | 3442 |
| 61 | Ga0466692_025737 | 3300042591 | Bacteria | 2334 |
| 62 | Ga0466711_065474 | 3300042615 | Bacteria | 59841 |
| 63 | Ga0466715_317032 | 3300042616 | Bacteria | 9183 |
| 64 | Ga0466723_273627 | 3300042618 | Bacteria | 3755 |
| 65 | Ga0466726_028586 | 3300042619 | Bacteria | 4115 |
| 66 | Ga0466700_256443 | 3300042600 | Bacteria | 1362 |
| 67 | Ga0466716_019376 | 3300042605 | Bacteria | 6255 |
| 68 | Ga0466722_019830 | 3300042609 | Bacteria | 1884 |
| 69 | Ga0466722_105268 | 3300042609 | Bacteria | 2229 |
| 70 | Ga0466722_200013 | 3300042609 | Bacteria | 1137 |
| 71 | Ga0466730_060479 | 3300042625 | Bacteria | 1143 |
| 72 | Ga0466703_093319 | 3300042636 | Bacteria | 1729 |
| 73 | Ga0466703_314357 | 3300042636 | Bacteria | 2177 |
| 74 | Ga0466708_216082 | 3300042652 | Bacteria | 3315 |
| 75 | Ga0466708_270608 | 3300042652 | Bacteria | 15036 |
| 76 | Ga0466690_082089 | 3300042590 | Bacteria | 1458 |
| 77 | Ga0466690_378931 | 3300042590 | Bacteria | 2126 |
| 78 | Ga0466692_083116 | 3300042591 | Bacteria | 14633 |
| 79 | Ga0466696_018826 | 3300042596 | Bacteria | 2544 |
| 80 | Ga0466696_064743 | 3300042596 | Bacteria | 12201 |
| 81 | Ga0466696_144566 | 3300042596 | Bacteria | 9127 |
| 82 | Ga0466696_147020 | 3300042596 | Bacteria | 2412 |
| 83 | Ga0466711_184629 | 3300042615 | Bacteria | 2017 |
| 84 | Ga0466723_167865 | 3300042618 | Bacteria | 6055 |
| 85 | Ga0466728_311386 | 3300042620 | Bacteria | 3981 |
| 86 | Ga0466722_092481 | 3300042609 | Bacteria | 1535 |
| 87 | Ga0466705_290891 | 3300042612 | Bacteria | 14318 |
| 88 | Ga0466733_087628 | 3300042659 | Bacteria | 3041 |
| 89 | Ga0466703_099912 | 3300042636 | Bacteria | 14070 |
| 90 | Ga0466703_113569 | 3300042636 | Bacteria | 4759 |
| 91 | Ga0466703_283587 | 3300042636 | Bacteria | 5285 |
| 92 | Ga0466709_107201 | 3300042648 | Bacteria | 1222 |
| 93 | Ga0466690_050724 | 3300042590 | Bacteria | 1182 |
| 94 | Ga0466690_385755 | 3300042590 | Bacteria | 3443 |
| 95 | Ga0466691_123696 | 3300042593 | Bacteria | 8908 |
| 96 | Ga0466691_149991 | 3300042593 | Bacteria | 3269 |
| 97 | Ga0466715_240670 | 3300042616 | Bacteria | 1939 |
| 98 | Ga0466716_081696 | 3300042605 | Bacteria | 3844 |
| 99 | Ga0466716_328850 | 3300042605 | Bacteria | 4879 |
| 100 | Ga0466719_009010 | 3300042606 | Bacteria | 9805 |
| 101 | Ga0466733_001372 | 3300042659 | Bacteria | 1406 |
| 102 | Ga0466733_025973 | 3300042659 | Bacteria | 5821 |
| 103 | Ga0466733_127183 | 3300042659 | Bacteria | 22629 |
| 104 | Ga0466729_219805 | 3300042621 | Bacteria | 1070 |
| 105 | Ga0466709_126036 | 3300042648 | Bacteria | 41880 |
| 106 | Ga0466690_132437 | 3300042590 | Bacteria | 1202 |
| 107 | Ga0466692_007017 | 3300042591 | Bacteria | 2456 |
| 108 | Ga0466692_138728 | 3300042591 | Bacteria | 1950 |
| 109 | Ga0466691_220441 | 3300042593 | Bacteria | 2540 |
| 110 | Ga0466696_040281 | 3300042596 | Bacteria | 4609 |
| 111 | Ga0466712_121841 | 3300042614 | Bacteria | 3186 |
| 112 | Ga0466715_156145 | 3300042616 | Bacteria | 1845 |
| 113 | Ga0466723_002889 | 3300042618 | Bacteria | 6478 |
| 114 | Ga0466726_047152 | 3300042619 | Bacteria | 1596 |
| 115 | Ga0466726_095556 | 3300042619 | Bacteria | 1778 |
| 116 | Ga0466726_306847 | 3300042619 | Bacteria | 1234 |
| 117 | Ga0466726_430556 | 3300042619 | Bacteria | 1537 |
| 118 | Ga0466728_327441 | 3300042620 | Bacteria | 1134 |
| 119 | Ga0466716_239926 | 3300042605 | Bacteria | 2766 |
| 120 | Ga0466719_260373 | 3300042606 | Bacteria | 26617 |
| 121 | Ga0466722_134137 | 3300042609 | Bacteria | 4890 |
| 122 | Ga0466722_200837 | 3300042609 | Bacteria | 1129 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.