Protein Family IF04921
Metagenome
Isolate
188
Members
67
Samples
177
Scaffolds
238.3
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_152855|Ga0466691_152855_4690_5475
- Length
- 261 aa
- Sequence
- MEKKRNSIEFKVSGRYALFSDPVTRVGGEKFSYQIPTYQALVGIAESICWKPTFRWIVDAVRVMKKIQTESKGIKTLQMDGTYPSLRNPAKKEARISDLSYYTYLRDVEYQVLAHFEWNEQRKELENDRDENKHHNIANRCVVKGGRRDIFLGTRECQAYVEPCVFSEGSGFYDNYGEIDFGVMFHGFDYPDDTGRPELSKRLWRGAKMKDGIVKFPPPNDTSLLRQIVRPSEMKRFVINCNFSLLKNDPSVADLLKEEKV
Sample Types
Isolate
5.8%
Metagenome
94.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.1%
Kalotermitidae
20.3%
Unclassified
15.6%
Rhinotermitidae
4.7%
Termopsidae
3.1%
Apidae
1.6%
Noctuidae
1.6%
Taxonomy
Archaea
2
Bacteria
154
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 28 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 33 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 34 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 37 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 46 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 47 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 48 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 53 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 54 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 55 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 57 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 58 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 59 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 60 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 61 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 62 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 63 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 64 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 65 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 66 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 67 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_159697 | 3300042659 | Bacteria | 2316 |
| 2 | Ga0466733_206181 | 3300042659 | Bacteria | 41168 |
| 3 | Ga0466711_260775 | 3300042615 | Bacteria | 21400 |
| 4 | Ga0466715_072537 | 3300042616 | Bacteria | 3364 |
| 5 | Ga0466715_447575 | 3300042616 | Bacteria | 8431 |
| 6 | Ga0466728_043411 | 3300042620 | Bacteria | 3690 |
| 7 | Ga0123353_10574053 | 3300010167 | Bacteria | 1620 |
| 8 | Ga0123353_10603045 | 3300010167 | Bacteria | 1569 |
| 9 | Ga0264413_139950 | 3300024493 | Bacteria | 4892 |
| 10 | Ga0466694_232382 | 3300042594 | Bacteria | 1109 |
| 11 | Ga0072941_1000156 | 3300005201 | Bacteria | 33336 |
| 12 | Ga0466701_092900 | 3300042598 | Bacteria | 10044 |
| 13 | Ga0466720_155764 | 3300042607 | Unclassified | 3135 |
| 14 | Ga0466698_236085 | 3300042610 | Unclassified | 1410 |
| 15 | Ga0466702_193803 | 3300042635 | Unclassified | 1799 |
| 16 | Ga0466727_319963 | 3300042655 | Bacteria | 1329 |
| 17 | Ga0466697_177209 | 3300042611 | Bacteria | 1551 |
| 18 | Ga0466733_100216 | 3300042659 | Bacteria | 2144 |
| 19 | Ga0466733_124560 | 3300042659 | Bacteria | 4120 |
| 20 | Ga0466712_294027 | 3300042614 | Bacteria | 1967 |
| 21 | Ga0466712_303658 | 3300042614 | Unclassified | 4000 |
| 22 | Ga0466711_218149 | 3300042615 | Bacteria | 5654 |
| 23 | Ga0466723_102346 | 3300042618 | Bacteria | 3415 |
| 24 | Ga0466726_386957 | 3300042619 | Bacteria | 3272 |
| 25 | Ga0123355_10666196 | 3300009826 | Bacteria | 1208 |
| 26 | Ga0123353_10171891 | 3300010167 | Bacteria | 3439 |
| 27 | Ga0123354_10058136 | 3300010882 | Bacteria | 5750 |
| 28 | Ga0160452_100084 | 3300012834 | Bacteria | 123536 |
| 29 | Ga0466691_019579 | 3300042593 | Bacteria | 8417 |
| 30 | JGI24698J34947_10000049 | 3300002449 | Bacteria | 34934 |
| 31 | JGI24702J35022_10087737 | 3300002462 | Bacteria | 1690 |
| 32 | JGI24702J35022_10155591 | 3300002462 | Bacteria | 1285 |
| 33 | Ga0072940_1018615 | 3300005200 | Bacteria | 3022 |
| 34 | Ga0466716_287739 | 3300042605 | Bacteria | 3516 |
| 35 | Ga0466720_090386 | 3300042607 | Bacteria | 8362 |
| 36 | Ga0466720_171316 | 3300042607 | Unclassified | 7905 |
| 37 | Ga0466721_011934 | 3300042608 | Unclassified | 13505 |
| 38 | Ga0466709_353231 | 3300042648 | Bacteria | 6996 |
| 39 | Ga0466708_384996 | 3300042652 | Unclassified | 1614 |
| 40 | Ga0466725_300568 | 3300042654 | Bacteria | 6233 |
| 41 | Ga0466732_000354 | 3300042656 | Archaea | 1386 |
| 42 | Ga0466712_042709 | 3300042614 | Bacteria | 1701 |
| 43 | Ga0123357_10307423 | 3300009784 | Bacteria | 1589 |
| 44 | Ga0123356_10001816 | 3300010049 | Bacteria | 23215 |
| 45 | Ga0123356_10718487 | 3300010049 | Bacteria | 1168 |
| 46 | Ga0123353_10069544 | 3300010167 | Bacteria | 5656 |
| 47 | Ga0123353_10204905 | 3300010167 | Bacteria | 3099 |
| 48 | Ga0415639_260796 | 3300038395 | Bacteria | 1433 |
| 49 | Ga0466691_063113 | 3300042593 | Bacteria | 8979 |
| 50 | Ga0466691_152855 | 3300042593 | Bacteria | 12476 |
| 51 | JGI24702J35022_10000969 | 3300002462 | Bacteria | 17944 |
| 52 | Ga0072940_1000937 | 3300005200 | Bacteria | 5175 |
| 53 | Ga0072940_1118906 | 3300005200 | Bacteria | 2151 |
| 54 | Ga0466714_157043 | 3300042603 | Bacteria | 9025 |
| 55 | Ga0466716_077160 | 3300042605 | Bacteria | 10135 |
| 56 | Ga0466719_037651 | 3300042606 | Unclassified | 1752 |
| 57 | Ga0466722_165605 | 3300042609 | Bacteria | 1825 |
| 58 | Ga0466704_418063 | 3300042643 | Bacteria | 2156 |
| 59 | Ga0466711_014504 | 3300042615 | Bacteria | 9096 |
| 60 | Ga0466715_084526 | 3300042616 | Bacteria | 2607 |
| 61 | Ga0466718_005294 | 3300042617 | Unclassified | 5812 |
| 62 | Ga0466718_088952 | 3300042617 | Unclassified | 4924 |
| 63 | Ga0123355_10038852 | 3300009826 | Bacteria | 7740 |
| 64 | Ga0123355_10113289 | 3300009826 | Bacteria | 4230 |
| 65 | Ga0123356_10676766 | 3300010049 | Bacteria | 1200 |
| 66 | Ga0123353_10276984 | 3300010167 | Bacteria | 2580 |
| 67 | Ga0466692_105895 | 3300042591 | Unclassified | 3954 |
| 68 | Ga0466696_018322 | 3300042596 | Bacteria | 8215 |
| 69 | Ga0466699_036159 | 3300042597 | Bacteria | 28818 |
| 70 | Ga0466699_358385 | 3300042597 | Bacteria | 1318 |
| 71 | AustNasuHG_c1008488 | 3300000089 | Unclassified | 3633 |
| 72 | JGI24698J34947_10011322 | 3300002449 | Unclassified | 4896 |
| 73 | JGI24702J35022_10002994 | 3300002462 | Bacteria | 10225 |
| 74 | JGI24702J35022_10095581 | 3300002462 | Bacteria | 1621 |
| 75 | JGI24697J35500_11040100 | 3300002507 | Unclassified | 1017 |
| 76 | Ga0072941_1092299 | 3300005201 | Bacteria | 5843 |
| 77 | Ga0466707_063121 | 3300042601 | Unclassified | 4853 |
| 78 | Ga0466716_514736 | 3300042605 | Bacteria | 2023 |
| 79 | Ga0466722_011440 | 3300042609 | Bacteria | 6876 |
| 80 | Ga0466698_098038 | 3300042610 | Unclassified | 1461 |
| 81 | Ga0466698_285420 | 3300042610 | Unclassified | 2451 |
| 82 | Ga0466733_202129 | 3300042659 | Bacteria | 2097 |
| 83 | Ga0123355_10050631 | 3300009826 | Bacteria | 6745 |
| 84 | Ga0123356_11497039 | 3300010049 | Bacteria | 833 |
| 85 | Ga0123353_10038493 | 3300010167 | Bacteria | 7515 |
| 86 | Ga0123353_10474945 | 3300010167 | Bacteria | 1831 |
| 87 | Ga0123354_10304664 | 3300010882 | Bacteria | 1500 |
| 88 | Ga0415639_043351 | 3300038395 | Bacteria | 8363 |
| 89 | Ga0466693_257437 | 3300042592 | Bacteria | 2629 |
| 90 | Ga0466694_375207 | 3300042594 | Unclassified | 1051 |
| 91 | JGI24700J35501_10930494 | 3300002508 | Bacteria | 14697 |
| 92 | JGI24696J40584_12953677 | 3300002834 | Unclassified | 2518 |
| 93 | Ga0466714_013129 | 3300042603 | Unclassified | 1194 |
| 94 | Ga0466720_047067 | 3300042607 | Bacteria | 74192 |
| 95 | Ga0466698_010692 | 3300042610 | Unclassified | 1478 |
| 96 | Ga0466702_230046 | 3300042635 | Bacteria | 6580 |
| 97 | Ga0466702_359819 | 3300042635 | Bacteria | 3677 |
| 98 | Ga0466727_040417 | 3300042655 | Bacteria | 1721 |
| 99 | Ga0466727_075392 | 3300042655 | Bacteria | 5347 |
| 100 | Ga0466705_020707 | 3300042612 | Bacteria | 3663 |
| 101 | Ga0466705_234501 | 3300042612 | Bacteria | 7028 |
| 102 | Ga0466711_060439 | 3300042615 | Bacteria | 5143 |
| 103 | Ga0466711_081712 | 3300042615 | Bacteria | 8339 |
| 104 | Ga0466718_000097 | 3300042617 | Bacteria | 1443 |
| 105 | Ga0466718_079970 | 3300042617 | Bacteria | 1145 |
| 106 | Ga0466718_088531 | 3300042617 | Bacteria | 2864 |
| 107 | Ga0466726_101375 | 3300042619 | Bacteria | 3416 |
| 108 | Ga0466726_269535 | 3300042619 | Unclassified | 1188 |
| 109 | Ga0466729_140911 | 3300042621 | Bacteria | 1864 |
| 110 | Ga0123355_10746871 | 3300009826 | Bacteria | 1108 |
| 111 | Ga0123353_10049090 | 3300010167 | Bacteria | 6723 |
| 112 | Ga0123354_10325961 | 3300010882 | Bacteria | 1409 |
| 113 | Ga0123354_10391936 | 3300010882 | Bacteria | 1186 |
| 114 | Ga0466692_165984 | 3300042591 | Bacteria | 3097 |
| 115 | AustNasuHG_c1000786 | 3300000089 | Bacteria | 11329 |
| 116 | AustNasuHG_c1002504 | 3300000089 | Bacteria | 6654 |
| 117 | AustNasuHG_c1003606 | 3300000089 | Unclassified | 5581 |
| 118 | JGI24698J34947_10018245 | 3300002449 | Unclassified | 3794 |
| 119 | JGI24695J34938_10006765 | 3300002450 | Bacteria | 6821 |
| 120 | JGI24702J35022_10007911 | 3300002462 | Bacteria | 6051 |
| 121 | JGI24702J35022_10077154 | 3300002462 | Unclassified | 1802 |
| 122 | JGI24705J35276_12234734 | 3300002504 | Bacteria | 5785 |
| 123 | Ga0466707_421122 | 3300042601 | Bacteria | 2153 |
| 124 | Ga0466714_003761 | 3300042603 | Unclassified | 1272 |
| 125 | Ga0466720_080848 | 3300042607 | Unclassified | 7070 |
| 126 | Ga0466730_027763 | 3300042625 | Bacteria | 3797 |
| 127 | Ga0466718_025727 | 3300042617 | Bacteria | 7945 |
| 128 | Ga0466718_075523 | 3300042617 | Bacteria | 2417 |
| 129 | Ga0466718_085524 | 3300042617 | Bacteria | 4125 |
| 130 | Ga0466723_070481 | 3300042618 | Bacteria | 15203 |
| 131 | Ga0466726_479787 | 3300042619 | Bacteria | 1252 |
| 132 | Ga0123355_10000118 | 3300009826 | Bacteria | 90212 |
| 133 | Ga0123355_10276034 | 3300009826 | Bacteria | 2327 |
| 134 | Ga0123355_10500727 | 3300009826 | Bacteria | 1499 |
| 135 | Ga0123356_10024879 | 3300010049 | Bacteria | 5629 |
| 136 | Ga0123356_10034790 | 3300010049 | Bacteria | 4708 |
| 137 | Ga0123353_10122278 | 3300010167 | Bacteria | 4184 |
| 138 | Ga0123353_10339010 | 3300010167 | Bacteria | 2271 |
| 139 | Ga0123353_10911047 | 3300010167 | Bacteria | 1195 |
| 140 | Ga0466690_158948 | 3300042590 | Bacteria | 6011 |
| 141 | Ga0466692_075926 | 3300042591 | Bacteria | 6359 |
| 142 | Ga0466691_069668 | 3300042593 | Bacteria | 13455 |
| 143 | Ga0466696_214271 | 3300042596 | Bacteria | 3862 |
| 144 | Ga0466699_148200 | 3300042597 | Bacteria | 5668 |
| 145 | JGI24698J34947_10002183 | 3300002449 | Bacteria | 10492 |
| 146 | JGI24695J34938_10004211 | 3300002450 | Bacteria | 9566 |
| 147 | Ga0072940_1005148 | 3300005200 | Unclassified | 6085 |
| 148 | Ga0466717_208363 | 3300042604 | Unclassified | 1044 |
| 149 | Ga0466719_158310 | 3300042606 | Bacteria | 12211 |
| 150 | Ga0466720_110725 | 3300042607 | Archaea | 24728 |
| 151 | Ga0466721_049037 | 3300042608 | Bacteria | 26773 |
| 152 | Ga0466698_388998 | 3300042610 | Unclassified | 1311 |
| 153 | Ga0466709_229188 | 3300042648 | Bacteria | 6945 |
| 154 | Ga0466727_102952 | 3300042655 | Bacteria | 2827 |
| 155 | Ga0466705_083962 | 3300042612 | Bacteria | 5390 |
| 156 | Ga0466733_010614 | 3300042659 | Bacteria | 10871 |
| 157 | Ga0466712_258805 | 3300042614 | Bacteria | 6597 |
| 158 | Ga0466715_262720 | 3300042616 | Bacteria | 2791 |
| 159 | Ga0466715_554461 | 3300042616 | Bacteria | 18652 |
| 160 | Ga0466728_349083 | 3300042620 | Bacteria | 7217 |
| 161 | Ga0123357_10515770 | 3300009784 | Bacteria | 980 |
| 162 | Ga0123355_10095127 | 3300009826 | Bacteria | 4710 |
| 163 | JGI24698J34947_10011618 | 3300002449 | Unclassified | 4833 |
| 164 | JGI24703J35330_11747629 | 3300002501 | Bacteria | 7498 |
| 165 | Ga0466700_050045 | 3300042600 | Bacteria | 9938 |
| 166 | Ga0466700_312581 | 3300042600 | Bacteria | 1288 |
| 167 | Ga0466700_327840 | 3300042600 | Unclassified | 1384 |
| 168 | Ga0466716_133010 | 3300042605 | Bacteria | 5510 |
| 169 | Ga0466719_087449 | 3300042606 | Bacteria | 2677 |
| 170 | Ga0466721_056353 | 3300042608 | Bacteria | 8518 |
| 171 | Ga0466722_023443 | 3300042609 | Bacteria | 22368 |
| 172 | Ga0466698_100173 | 3300042610 | Bacteria | 4763 |
| 173 | Ga0466698_282105 | 3300042610 | Bacteria | 1894 |
| 174 | Ga0466708_078035 | 3300042652 | Bacteria | 7102 |
| 175 | Ga0466725_040148 | 3300042654 | Bacteria | 3901 |
| 176 | Ga0466725_331977 | 3300042654 | Bacteria | 8202 |
| 177 | Ga0466727_215306 | 3300042655 | Bacteria | 1040 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09704 | Cas_Cas5d | CRISPR-associated protein (Cas_Cas5) | 8 | 216 | 0.88 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF09704 | GO:0043571 | maintenance of CRISPR repeat elements | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.