Protein Family IF04916
Metagenome
Isolate
159
Members
33
Samples
158
Scaffolds
202.34
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_135133|Ga0466691_135133_7155_7814
- Length
- 219 aa
- Sequence
- MDAVQYNNPPPLCYASFMKKEFLPYDIVRDNALKLACKIYGDGFMPDVIYVSLRGGAYLGNVISEYFKVIKHQGRPVYYAAVVARSYTDVRKSDQIKVEGWTYAPEHLRIGDKVLLVDDIFDSGKTINHLAGIILERGIPRQDLKVAVHDYKHFFDKDDQLPVQPDYWCRKHDLSVNDEDRWIHYMSHELVGLSPQELEEHYYKRDGELRDVLSVLEKP
Sample Types
Isolate
0.6%
Metagenome
99.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
43.8%
Termitidae
28.1%
Unclassified
9.4%
Termopsidae
9.4%
Rhinotermitidae
6.2%
Hodotermitidae
3.1%
Taxonomy
Archaea
0
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 6 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 7 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 8 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_113524 | 3300042659 | Bacteria | 13369 |
| 2 | Ga0466715_180557 | 3300042616 | Bacteria | 19325 |
| 3 | Ga0466715_286076 | 3300042616 | Bacteria | 13194 |
| 4 | Ga0466715_409965 | 3300042616 | Bacteria | 2407 |
| 5 | Ga0466723_183729 | 3300042618 | Bacteria | 1962 |
| 6 | Ga0466726_392829 | 3300042619 | Bacteria | 1705 |
| 7 | Ga0466728_254550 | 3300042620 | Bacteria | 6144 |
| 8 | Ga0466728_306184 | 3300042620 | Bacteria | 6150 |
| 9 | Ga0466706_088796 | 3300042599 | Bacteria | 1754 |
| 10 | Ga0466707_398554 | 3300042601 | Bacteria | 11511 |
| 11 | Ga0466719_197195 | 3300042606 | Bacteria | 18174 |
| 12 | Ga0466690_073472 | 3300042590 | Bacteria | 4463 |
| 13 | Ga0466691_165988 | 3300042593 | Bacteria | 9399 |
| 14 | Ga0466691_210489 | 3300042593 | Bacteria | 6638 |
| 15 | Ga0466694_039859 | 3300042594 | Bacteria | 8478 |
| 16 | AustNasuHG_c1001395 | 3300000089 | Bacteria | 8659 |
| 17 | Ga0466703_282100 | 3300042636 | Unclassified | 14641 |
| 18 | Ga0466708_308937 | 3300042652 | Bacteria | 19894 |
| 19 | Ga0466708_368772 | 3300042652 | Bacteria | 50694 |
| 20 | Ga0466733_056535 | 3300042659 | Unclassified | 2177 |
| 21 | Ga0466711_187139 | 3300042615 | Bacteria | 12512 |
| 22 | Ga0466715_126880 | 3300042616 | Bacteria | 24039 |
| 23 | Ga0466715_161310 | 3300042616 | Bacteria | 19000 |
| 24 | Ga0466723_137171 | 3300042618 | Bacteria | 27700 |
| 25 | Ga0466726_378497 | 3300042619 | Bacteria | 7862 |
| 26 | Ga0466728_012450 | 3300042620 | Bacteria | 2281 |
| 27 | Ga0466728_309369 | 3300042620 | Bacteria | 2278 |
| 28 | Ga0466716_073833 | 3300042605 | Bacteria | 4446 |
| 29 | Ga0466719_013569 | 3300042606 | Bacteria | 6191 |
| 30 | Ga0466719_054464 | 3300042606 | Bacteria | 2121 |
| 31 | Ga0466719_571511 | 3300042606 | Bacteria | 1910 |
| 32 | Ga0466690_028407 | 3300042590 | Bacteria | 8409 |
| 33 | Ga0466691_076310 | 3300042593 | Bacteria | 4613 |
| 34 | Ga0466691_135133 | 3300042593 | Bacteria | 8653 |
| 35 | Ga0466691_139248 | 3300042593 | Bacteria | 6669 |
| 36 | Ga0466694_313403 | 3300042594 | Bacteria | 1822 |
| 37 | Ga0466695_129645 | 3300042595 | Bacteria | 1498 |
| 38 | Ga0466695_213185 | 3300042595 | Bacteria | 1248 |
| 39 | Ga0466696_259191 | 3300042596 | Bacteria | 12172 |
| 40 | Ga0466696_408774 | 3300042596 | Bacteria | 2529 |
| 41 | Ga0466705_086060 | 3300042612 | Unclassified | 9623 |
| 42 | Ga0466735_052860 | 3300042624 | Bacteria | 6815 |
| 43 | Ga0466735_069888 | 3300042624 | Bacteria | 1999 |
| 44 | Ga0466703_090946 | 3300042636 | Bacteria | 4285 |
| 45 | Ga0466703_368492 | 3300042636 | Bacteria | 2464 |
| 46 | Ga0466704_019721 | 3300042643 | Bacteria | 3202 |
| 47 | Ga0466704_037742 | 3300042643 | Bacteria | 13459 |
| 48 | Ga0466704_160897 | 3300042643 | Bacteria | 15593 |
| 49 | Ga0466704_277279 | 3300042643 | Bacteria | 14132 |
| 50 | Ga0466709_317487 | 3300042648 | Bacteria | 4322 |
| 51 | Ga0466708_351790 | 3300042652 | Bacteria | 6839 |
| 52 | Ga0466711_177185 | 3300042615 | Bacteria | 36654 |
| 53 | Ga0466711_417672 | 3300042615 | Bacteria | 4742 |
| 54 | Ga0466728_180070 | 3300042620 | Bacteria | 4061 |
| 55 | Ga0466716_235214 | 3300042605 | Bacteria | 6738 |
| 56 | Ga0466719_022449 | 3300042606 | Bacteria | 69327 |
| 57 | Ga0466719_267200 | 3300042606 | Unclassified | 39450 |
| 58 | Ga0466690_149481 | 3300042590 | Bacteria | 1271 |
| 59 | Ga0466690_391157 | 3300042590 | Bacteria | 1804 |
| 60 | Ga0466692_029489 | 3300042591 | Bacteria | 35563 |
| 61 | Ga0466696_084222 | 3300042596 | Bacteria | 2478 |
| 62 | Ga0466705_262400 | 3300042612 | Bacteria | 2751 |
| 63 | Ga0466703_325115 | 3300042636 | Bacteria | 26641 |
| 64 | Ga0466727_112822 | 3300042655 | Bacteria | 1535 |
| 65 | Ga0466712_242265 | 3300042614 | Bacteria | 1463 |
| 66 | Ga0466723_021746 | 3300042618 | Bacteria | 41971 |
| 67 | Ga0466723_173115 | 3300042618 | Bacteria | 6392 |
| 68 | Ga0466728_009027 | 3300042620 | Bacteria | 1953 |
| 69 | Ga0466706_005424 | 3300042599 | Bacteria | 1190 |
| 70 | Ga0466716_185390 | 3300042605 | Bacteria | 27438 |
| 71 | Ga0466719_047734 | 3300042606 | Bacteria | 7681 |
| 72 | Ga0466690_015646 | 3300042590 | Bacteria | 8101 |
| 73 | Ga0466691_112294 | 3300042593 | Bacteria | 3642 |
| 74 | Ga0466696_172238 | 3300042596 | Bacteria | 24315 |
| 75 | Ga0466696_362999 | 3300042596 | Bacteria | 7087 |
| 76 | Ga0466735_097181 | 3300042624 | Bacteria | 1200 |
| 77 | Ga0466709_188703 | 3300042648 | Bacteria | 9107 |
| 78 | Ga0466709_307383 | 3300042648 | Bacteria | 7117 |
| 79 | Ga0466709_346326 | 3300042648 | Bacteria | 6773 |
| 80 | Ga0466708_313704 | 3300042652 | Bacteria | 3454 |
| 81 | Ga0466732_420598 | 3300042656 | Bacteria | 2290 |
| 82 | Ga0466733_141867 | 3300042659 | Bacteria | 123412 |
| 83 | Ga0466705_444115 | 3300042612 | Bacteria | 2518 |
| 84 | Ga0466711_346516 | 3300042615 | Bacteria | 4341 |
| 85 | Ga0466715_114308 | 3300042616 | Bacteria | 5948 |
| 86 | Ga0466715_257439 | 3300042616 | Bacteria | 4424 |
| 87 | Ga0466715_594566 | 3300042616 | Bacteria | 5488 |
| 88 | Ga0466723_069054 | 3300042618 | Bacteria | 10232 |
| 89 | Ga0466707_036117 | 3300042601 | Unclassified | 1194 |
| 90 | Ga0466707_173476 | 3300042601 | Bacteria | 1529 |
| 91 | Ga0466716_072241 | 3300042605 | Bacteria | 6544 |
| 92 | Ga0466716_164248 | 3300042605 | Bacteria | 2829 |
| 93 | Ga0466719_554461 | 3300042606 | Bacteria | 1429 |
| 94 | Ga0466691_085285 | 3300042593 | Bacteria | 10719 |
| 95 | Ga0466694_003885 | 3300042594 | Bacteria | 6045 |
| 96 | Ga0466694_128975 | 3300042594 | Bacteria | 1377 |
| 97 | Ga0466699_031375 | 3300042597 | Bacteria | 4772 |
| 98 | Ga0466705_193172 | 3300042612 | Bacteria | 4526 |
| 99 | Ga0466703_350882 | 3300042636 | Bacteria | 30976 |
| 100 | Ga0466703_379255 | 3300042636 | Bacteria | 6194 |
| 101 | Ga0466704_225547 | 3300042643 | Bacteria | 39919 |
| 102 | Ga0466733_197779 | 3300042659 | Bacteria | 1515 |
| 103 | Ga0466705_460934 | 3300042612 | Bacteria | 6920 |
| 104 | Ga0466715_350176 | 3300042616 | Bacteria | 41481 |
| 105 | Ga0466723_303395 | 3300042618 | Bacteria | 2189 |
| 106 | Ga0466723_326724 | 3300042618 | Bacteria | 5284 |
| 107 | Ga0466726_450955 | 3300042619 | Bacteria | 5534 |
| 108 | Ga0466728_231062 | 3300042620 | Bacteria | 10677 |
| 109 | Ga0123353_10139595 | 3300010167 | Bacteria | 3883 |
| 110 | Ga0466691_003605 | 3300042593 | Bacteria | 2241 |
| 111 | Ga0466694_387293 | 3300042594 | Bacteria | 3444 |
| 112 | Ga0072941_1004355 | 3300005201 | Bacteria | 7844 |
| 113 | Ga0466703_072822 | 3300042636 | Bacteria | 7939 |
| 114 | Ga0466709_299315 | 3300042648 | Bacteria | 3291 |
| 115 | Ga0466708_106623 | 3300042652 | Bacteria | 34173 |
| 116 | Ga0466708_114067 | 3300042652 | Bacteria | 17228 |
| 117 | Ga0466708_427986 | 3300042652 | Bacteria | 4496 |
| 118 | Ga0466727_335260 | 3300042655 | Bacteria | 1240 |
| 119 | Ga0466711_025617 | 3300042615 | Bacteria | 25221 |
| 120 | Ga0466715_196890 | 3300042616 | Bacteria | 23985 |
| 121 | Ga0466715_386787 | 3300042616 | Bacteria | 2005 |
| 122 | Ga0466723_203022 | 3300042618 | Bacteria | 7211 |
| 123 | Ga0466726_216579 | 3300042619 | Bacteria | 9703 |
| 124 | Ga0466728_478907 | 3300042620 | Bacteria | 9355 |
| 125 | Ga0466691_127111 | 3300042593 | Unclassified | 2320 |
| 126 | Ga0466699_381835 | 3300042597 | Bacteria | 1326 |
| 127 | Ga0466705_069693 | 3300042612 | Bacteria | 1291 |
| 128 | Ga0466704_344794 | 3300042643 | Bacteria | 31351 |
| 129 | Ga0466704_493603 | 3300042643 | Bacteria | 2756 |
| 130 | Ga0466709_338581 | 3300042648 | Bacteria | 14434 |
| 131 | Ga0466708_003239 | 3300042652 | Bacteria | 10312 |
| 132 | Ga0466708_207706 | 3300042652 | Unclassified | 4687 |
| 133 | Ga0466727_338602 | 3300042655 | Bacteria | 1327 |
| 134 | Ga0466733_051843 | 3300042659 | Unclassified | 2045 |
| 135 | Ga0466733_104558 | 3300042659 | Unclassified | 1473 |
| 136 | Ga0466712_024404 | 3300042614 | Bacteria | 1136 |
| 137 | Ga0466711_383156 | 3300042615 | Bacteria | 3810 |
| 138 | Ga0466715_049681 | 3300042616 | Bacteria | 7740 |
| 139 | Ga0466723_194613 | 3300042618 | Bacteria | 8152 |
| 140 | Ga0466707_026335 | 3300042601 | Bacteria | 1287 |
| 141 | Ga0466707_123599 | 3300042601 | Bacteria | 2923 |
| 142 | Ga0466713_101717 | 3300042602 | Bacteria | 4729 |
| 143 | Ga0466719_475498 | 3300042606 | Bacteria | 1939 |
| 144 | Ga0466722_149727 | 3300042609 | Bacteria | 8987 |
| 145 | Ga0123357_10005677 | 3300009784 | Bacteria | 15005 |
| 146 | Ga0123353_10283795 | 3300010167 | Bacteria | 2540 |
| 147 | Ga0466692_019941 | 3300042591 | Bacteria | 3649 |
| 148 | Ga0466692_097164 | 3300042591 | Bacteria | 2091 |
| 149 | Ga0466696_345523 | 3300042596 | Bacteria | 48190 |
| 150 | Ga0466705_088182 | 3300042612 | Bacteria | 1888 |
| 151 | Ga0466705_183972 | 3300042612 | Bacteria | 1819 |
| 152 | Ga0466735_196482 | 3300042624 | Bacteria | 1790 |
| 153 | Ga0466704_041316 | 3300042643 | Bacteria | 13141 |
| 154 | Ga0466709_145172 | 3300042648 | Bacteria | 1597 |
| 155 | Ga0466708_090236 | 3300042652 | Bacteria | 5175 |
| 156 | Ga0466708_238227 | 3300042652 | Bacteria | 3400 |
| 157 | Ga0466708_438786 | 3300042652 | Bacteria | 1322 |
| 158 | Ga0466727_196810 | 3300042655 | Unclassified | 3023 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00156 | Pribosyltran | Phosphoribosyl transferase domain | 32 | 138 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.