Protein Family IF04873
Metagenome
Isolate
122
Members
49
Samples
115
Scaffolds
96.83
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_070653|Ga0466691_070653_532_939
- Length
- 111 aa
- Sequence
- MLLASCKPGYHRSMCWYCGEAISDTETPGRSMRCGICGKDLRSCRNCRFFLPGSRGDCSETNAEPQADKERGNFCDWFSLNPRFRSASAGEQKSRGAAADAKSAFEGLFKD
Sample Types
Isolate
5.7%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.4%
Kalotermitidae
27.7%
Unclassified
19.1%
Rhinotermitidae
8.5%
Termopsidae
4.3%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 4 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 5 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 6 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 38 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 39 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 40 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 41 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 42 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 43 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 44 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 45 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 46 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 47 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 48 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_060331 | 3300042612 | Bacteria | 4947 |
| 2 | Ga0466733_216898 | 3300042659 | Bacteria | 3841 |
| 3 | Ga0466712_001431 | 3300042614 | Bacteria | 1083 |
| 4 | Ga0466718_108588 | 3300042617 | Bacteria | 22533 |
| 5 | Ga0466726_140927 | 3300042619 | Bacteria | 3036 |
| 6 | Ga0123353_10930785 | 3300010167 | Bacteria | 1179 |
| 7 | Ga0123353_11644727 | 3300010167 | Bacteria | 808 |
| 8 | Ga0264413_107675 | 3300024493 | Bacteria | 2843 |
| 9 | Ga0466690_034257 | 3300042590 | Bacteria | 1579 |
| 10 | Ga0466694_105495 | 3300042594 | Bacteria | 6347 |
| 11 | Ga0466702_163334 | 3300042635 | Bacteria | 1099 |
| 12 | Ga0466708_085424 | 3300042652 | Bacteria | 2208 |
| 13 | Ga0466713_041901 | 3300042602 | Bacteria | 3990 |
| 14 | Ga0466713_135223 | 3300042602 | Bacteria | 7210 |
| 15 | Ga0466716_215456 | 3300042605 | Bacteria | 13755 |
| 16 | Ga0466719_135362 | 3300042606 | Bacteria | 51759 |
| 17 | Ga0072940_1201296 | 3300005200 | Bacteria | 1434 |
| 18 | Ga0072941_1020253 | 3300005201 | Bacteria | 5568 |
| 19 | Ga0466712_162409 | 3300042614 | Bacteria | 2022 |
| 20 | Ga0466712_190252 | 3300042614 | Bacteria | 5187 |
| 21 | Ga0466727_211129 | 3300042655 | Bacteria | 1335 |
| 22 | Ga0466707_239489 | 3300042601 | Bacteria | 1576 |
| 23 | Ga0466717_134853 | 3300042604 | Bacteria | 1064 |
| 24 | Ga0466722_180270 | 3300042609 | Bacteria | 21543 |
| 25 | Ga0466698_148865 | 3300042610 | Bacteria | 1420 |
| 26 | JGI24698J34947_10003122 | 3300002449 | Bacteria | 8976 |
| 27 | Ga0072941_1099012 | 3300005201 | Bacteria | 1447 |
| 28 | Ga0466711_160386 | 3300042615 | Bacteria | 4147 |
| 29 | Ga0466726_029852 | 3300042619 | Bacteria | 1382 |
| 30 | Ga0466694_041245 | 3300042594 | Bacteria | 28390 |
| 31 | Ga0466699_050454 | 3300042597 | Bacteria | 3590 |
| 32 | Ga0466704_449099 | 3300042643 | Bacteria | 67975 |
| 33 | Ga0466709_118869 | 3300042648 | Bacteria | 2233 |
| 34 | Ga0466722_152166 | 3300042609 | Bacteria | 6164 |
| 35 | Ga0466698_011176 | 3300042610 | Bacteria | 17753 |
| 36 | AustNasuHG_c1000381 | 3300000089 | Bacteria | 15405 |
| 37 | JGI24698J34947_10003677 | 3300002449 | Unclassified | 8339 |
| 38 | JGI24700J35501_10929822 | 3300002508 | Bacteria | 10309 |
| 39 | Ga0466712_010120 | 3300042614 | Bacteria | 5370 |
| 40 | Ga0466712_061073 | 3300042614 | Unclassified | 3679 |
| 41 | Ga0466711_045928 | 3300042615 | Bacteria | 1094 |
| 42 | Ga0466718_169441 | 3300042617 | Bacteria | 1699 |
| 43 | Ga0466723_022695 | 3300042618 | Bacteria | 15683 |
| 44 | Ga0264413_102406 | 3300024493 | Bacteria | 6641 |
| 45 | Ga0466690_325687 | 3300042590 | Bacteria | 6079 |
| 46 | Ga0466691_070653 | 3300042593 | Bacteria | 1706 |
| 47 | Ga0466694_033406 | 3300042594 | Bacteria | 2180 |
| 48 | Ga0466694_270608 | 3300042594 | Bacteria | 1304 |
| 49 | Ga0466699_333830 | 3300042597 | Bacteria | 1279 |
| 50 | Ga0466702_142590 | 3300042635 | Bacteria | 1815 |
| 51 | Ga0466703_164458 | 3300042636 | Bacteria | 1309 |
| 52 | Ga0466727_113849 | 3300042655 | Bacteria | 1283 |
| 53 | JGI24698J34947_10003810 | 3300002449 | Bacteria | 8215 |
| 54 | JGI24698J34947_10011181 | 3300002449 | Bacteria | 4927 |
| 55 | JGI24698J34947_10029846 | 3300002449 | Bacteria | 2878 |
| 56 | JGI24698J34947_10041501 | 3300002449 | Bacteria | 2370 |
| 57 | JGI24695J34938_10019173 | 3300002450 | Bacteria | 3398 |
| 58 | Ga0466712_167627 | 3300042614 | Unclassified | 13851 |
| 59 | Ga0466712_192862 | 3300042614 | Bacteria | 9459 |
| 60 | Ga0466715_419555 | 3300042616 | Bacteria | 2852 |
| 61 | Ga0466718_061544 | 3300042617 | Bacteria | 1035 |
| 62 | Ga0466728_251170 | 3300042620 | Bacteria | 1018 |
| 63 | Ga0123356_10000788 | 3300010049 | Bacteria | 35154 |
| 64 | Ga0123356_10216903 | 3300010049 | Bacteria | 1967 |
| 65 | Ga0123353_12259681 | 3300010167 | Bacteria | 656 |
| 66 | Ga0466692_158584 | 3300042591 | Bacteria | 2305 |
| 67 | Ga0466702_037282 | 3300042635 | Bacteria | 1607 |
| 68 | Ga0466708_292864 | 3300042652 | Bacteria | 5851 |
| 69 | Ga0466700_461778 | 3300042600 | Bacteria | 1164 |
| 70 | Ga0466719_039449 | 3300042606 | Bacteria | 10193 |
| 71 | JGI24698J34947_10006961 | 3300002449 | Bacteria | 6219 |
| 72 | JGI24698J34947_10017416 | 3300002449 | Unclassified | 3893 |
| 73 | JGI24698J34947_10078054 | 3300002449 | Bacteria | 1563 |
| 74 | Ga0466732_017114 | 3300042656 | Bacteria | 1219 |
| 75 | Ga0466712_210733 | 3300042614 | Unclassified | 1782 |
| 76 | Ga0466715_004908 | 3300042616 | Bacteria | 1414 |
| 77 | Ga0466715_222045 | 3300042616 | Bacteria | 16267 |
| 78 | Ga0466715_348294 | 3300042616 | Bacteria | 8924 |
| 79 | Ga0466718_035266 | 3300042617 | Bacteria | 1001 |
| 80 | Ga0123353_11765863 | 3300010167 | Bacteria | 771 |
| 81 | Ga0466699_060657 | 3300042597 | Bacteria | 1172 |
| 82 | Ga0466699_327189 | 3300042597 | Bacteria | 8958 |
| 83 | Ga0466708_348829 | 3300042652 | Bacteria | 2890 |
| 84 | Ga0466722_165775 | 3300042609 | Unclassified | 12993 |
| 85 | JGI24698J34947_10149171 | 3300002449 | Bacteria | 974 |
| 86 | JGI24695J34938_10006586 | 3300002450 | Bacteria | 6937 |
| 87 | JGI24695J34938_10010180 | 3300002450 | Bacteria | 5177 |
| 88 | JGI24699J35502_11132010 | 3300002509 | Unclassified | 6273 |
| 89 | Ga0466705_146047 | 3300042612 | Bacteria | 8415 |
| 90 | Ga0466718_165376 | 3300042617 | Bacteria | 8126 |
| 91 | Ga0123356_10550370 | 3300010049 | Bacteria | 1315 |
| 92 | Ga0123356_12335059 | 3300010049 | Bacteria | 669 |
| 93 | Ga0123353_10186850 | 3300010167 | Bacteria | 3276 |
| 94 | Ga0456237_0002138 | 3300041968 | Bacteria | 3190 |
| 95 | Ga0466694_107473 | 3300042594 | Bacteria | 12890 |
| 96 | Ga0466699_305108 | 3300042597 | Bacteria | 4404 |
| 97 | Ga0466729_209850 | 3300042621 | Bacteria | 1307 |
| 98 | Ga0466707_019519 | 3300042601 | Bacteria | 1535 |
| 99 | Ga0466719_404610 | 3300042606 | Bacteria | 6017 |
| 100 | JGI24698J34947_10002727 | 3300002449 | Bacteria | 9538 |
| 101 | JGI24698J34947_10267431 | 3300002449 | Bacteria | 631 |
| 102 | JGI24695J34938_10001895 | 3300002450 | Bacteria | 16940 |
| 103 | JGI24702J35022_10001630 | 3300002462 | Bacteria | 13908 |
| 104 | Ga0466733_136397 | 3300042659 | Bacteria | 9540 |
| 105 | Ga0466712_168509 | 3300042614 | Bacteria | 1019 |
| 106 | Ga0466715_154486 | 3300042616 | Bacteria | 10903 |
| 107 | Ga0466726_476085 | 3300042619 | Bacteria | 2282 |
| 108 | Ga0123356_10012628 | 3300010049 | Bacteria | 8190 |
| 109 | Ga0123356_11289924 | 3300010049 | Bacteria | 894 |
| 110 | Ga0123353_10252786 | 3300010167 | Bacteria | 2728 |
| 111 | Ga0466699_107752 | 3300042597 | Bacteria | 12714 |
| 112 | Ga0466716_515684 | 3300042605 | Bacteria | 10421 |
| 113 | JGI24695J34938_10002883 | 3300002450 | Bacteria | 12524 |
| 114 | JGI24695J34938_10026674 | 3300002450 | Bacteria | 2742 |
| 115 | Ga0072941_1081970 | 3300005201 | Bacteria | 6129 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.