Protein Family IF04845
Metagenome
Isolate
171
Members
41
Samples
164
Scaffolds
141.99
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_032020|Ga0466691_032020_6686_7240
- Length
- 179 aa
- Sequence
- MRGVCGKMPVSRAEAVGIRRGTWRARTPLKIKGWGAALFIFSKMNNARVDPNITFSLDAANGMPIYRQIIQQIEYAILSERLKSGDRLPTIRALAVELKINPNTIAKAYNELEIRGVLVTQVGSGTFISNKKPEAPESSIEDIRNRKIQEVLGRFMQELEDLGLGKDKILELIRNSNAP
Sample Types
Isolate
4.1%
Metagenome
95.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
60.0%
Unclassified
17.5%
Kalotermitidae
10.0%
Termopsidae
7.5%
Rhinotermitidae
5.0%
Taxonomy
Archaea
0
Bacteria
154
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 2 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 3 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 4 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 5 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 6 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 7 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 8 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 9 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 26 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 37 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466720_022729 | 3300042607 | Bacteria | 5530 |
| 2 | Ga0466720_080310 | 3300042607 | Unclassified | 1601 |
| 3 | Ga0466722_177822 | 3300042609 | Bacteria | 1706 |
| 4 | Ga0466712_037818 | 3300042614 | Bacteria | 2583 |
| 5 | Ga0466712_105425 | 3300042614 | Bacteria | 6318 |
| 6 | Ga0466712_152920 | 3300042614 | Bacteria | 1084 |
| 7 | Ga0466712_309767 | 3300042614 | Bacteria | 1231 |
| 8 | Ga0123355_11857587 | 3300009826 | Bacteria | 565 |
| 9 | Ga0123356_10000425 | 3300010049 | Bacteria | 48140 |
| 10 | Ga0123356_10006055 | 3300010049 | Bacteria | 12271 |
| 11 | Ga0123356_11356684 | 3300010049 | Bacteria | 873 |
| 12 | Ga0123353_10347928 | 3300010167 | Bacteria | 2235 |
| 13 | Ga0123353_10462030 | 3300010167 | Bacteria | 1865 |
| 14 | AustNasuHG_c1031130 | 3300000089 | Bacteria | 1516 |
| 15 | AustNasuHG_c1032191 | 3300000089 | Bacteria | 1460 |
| 16 | JGI24698J34947_10037243 | 3300002449 | Bacteria | 2528 |
| 17 | JGI24698J34947_10087544 | 3300002449 | Bacteria | 1440 |
| 18 | JGI24698J34947_10144393 | 3300002449 | Bacteria | 997 |
| 19 | JGI24695J34938_10032076 | 3300002450 | Bacteria | 2431 |
| 20 | Ga0068302_10273384 | 3300005071 | Bacteria | 1672 |
| 21 | Ga0466702_295140 | 3300042635 | Bacteria | 1003 |
| 22 | Ga0466727_125452 | 3300042655 | Bacteria | 1203 |
| 23 | Ga0466732_065019 | 3300042656 | Unclassified | 7591 |
| 24 | Ga0466720_002832 | 3300042607 | Bacteria | 2827 |
| 25 | Ga0466720_076660 | 3300042607 | Bacteria | 19001 |
| 26 | Ga0466712_143385 | 3300042614 | Unclassified | 3144 |
| 27 | Ga0466712_148184 | 3300042614 | Bacteria | 3223 |
| 28 | Ga0466712_175317 | 3300042614 | Unclassified | 1798 |
| 29 | Ga0415639_131941 | 3300038395 | Unclassified | 2155 |
| 30 | AustNasuHG_c1044571 | 3300000089 | Bacteria | 1026 |
| 31 | JGI24698J34947_10040610 | 3300002449 | Bacteria | 2401 |
| 32 | JGI24698J34947_10065697 | 3300002449 | Bacteria | 1768 |
| 33 | JGI24698J34947_10103121 | 3300002449 | Unclassified | 1277 |
| 34 | JGI24698J34947_10127808 | 3300002449 | Bacteria | 1092 |
| 35 | JGI24695J34938_10020060 | 3300002450 | Bacteria | 3297 |
| 36 | JGI24695J34938_10069397 | 3300002450 | Bacteria | 1477 |
| 37 | Ga0072940_1006933 | 3300005200 | Bacteria | 1896 |
| 38 | Ga0072941_1109437 | 3300005201 | Bacteria | 1798 |
| 39 | Ga0466720_041891 | 3300042607 | Bacteria | 2763 |
| 40 | Ga0466712_011163 | 3300042614 | Unclassified | 4556 |
| 41 | Ga0466712_114248 | 3300042614 | Bacteria | 6489 |
| 42 | Ga0466726_427454 | 3300042619 | Bacteria | 1478 |
| 43 | Ga0123356_10231347 | 3300010049 | Bacteria | 1913 |
| 44 | Ga0123353_10369299 | 3300010167 | Bacteria | 2152 |
| 45 | Ga0466692_008673 | 3300042591 | Bacteria | 2039 |
| 46 | Ga0466691_032020 | 3300042593 | Bacteria | 19829 |
| 47 | Ga0466694_351366 | 3300042594 | Unclassified | 1845 |
| 48 | Ga0466699_046757 | 3300042597 | Bacteria | 3318 |
| 49 | Ga0466699_221031 | 3300042597 | Bacteria | 2085 |
| 50 | AustNasuHG_c1015414 | 3300000089 | Bacteria | 2578 |
| 51 | AustNasuHG_c1019684 | 3300000089 | Unclassified | 2211 |
| 52 | AustNasuHG_c1029174 | 3300000089 | Unclassified | 1625 |
| 53 | JGI24698J34947_10024321 | 3300002449 | Bacteria | 3235 |
| 54 | JGI24698J34947_10107659 | 3300002449 | Unclassified | 1237 |
| 55 | JGI24695J34938_10000768 | 3300002450 | Bacteria | 30031 |
| 56 | JGI24695J34938_10001200 | 3300002450 | Bacteria | 22953 |
| 57 | JGI24695J34938_10015059 | 3300002450 | Bacteria | 3982 |
| 58 | JGI24695J34938_10415598 | 3300002450 | Unclassified | 602 |
| 59 | JGI24702J35022_10952623 | 3300002462 | Bacteria | 534 |
| 60 | JGI24699J35502_10576314 | 3300002509 | Bacteria | 665 |
| 61 | Ga0466702_207013 | 3300042635 | Bacteria | 2496 |
| 62 | Ga0466700_308213 | 3300042600 | Bacteria | 5249 |
| 63 | Ga0466720_070685 | 3300042607 | Bacteria | 5374 |
| 64 | Ga0466720_175064 | 3300042607 | Unclassified | 1767 |
| 65 | Ga0466698_150473 | 3300042610 | Bacteria | 1037 |
| 66 | Ga0466712_023839 | 3300042614 | Bacteria | 59773 |
| 67 | Ga0466712_045940 | 3300042614 | Unclassified | 5378 |
| 68 | Ga0466712_051543 | 3300042614 | Bacteria | 4954 |
| 69 | Ga0466712_063276 | 3300042614 | Bacteria | 1912 |
| 70 | Ga0466712_115313 | 3300042614 | Bacteria | 6125 |
| 71 | Ga0466712_121066 | 3300042614 | Bacteria | 11552 |
| 72 | Ga0466711_289524 | 3300042615 | Bacteria | 53110 |
| 73 | Ga0466711_333849 | 3300042615 | Bacteria | 8643 |
| 74 | Ga0466718_006759 | 3300042617 | Bacteria | 1707 |
| 75 | Ga0466723_241432 | 3300042618 | Bacteria | 1522 |
| 76 | Ga0123356_10115593 | 3300010049 | Bacteria | 2600 |
| 77 | Ga0466694_000605 | 3300042594 | Bacteria | 22276 |
| 78 | Ga0466694_098736 | 3300042594 | Bacteria | 1021 |
| 79 | Ga0466699_002716 | 3300042597 | Bacteria | 1434 |
| 80 | Ga0466699_211009 | 3300042597 | Bacteria | 48420 |
| 81 | JGI24698J34947_10034677 | 3300002449 | Bacteria | 2638 |
| 82 | JGI24698J34947_10037514 | 3300002449 | Bacteria | 2517 |
| 83 | JGI24698J34947_10064540 | 3300002449 | Bacteria | 1789 |
| 84 | JGI24698J34947_10083372 | 3300002449 | Bacteria | 1492 |
| 85 | JGI24698J34947_10148851 | 3300002449 | Bacteria | 975 |
| 86 | JGI24695J34938_10001679 | 3300002450 | Bacteria | 18333 |
| 87 | Ga0072941_1024993 | 3300005201 | Bacteria | 3642 |
| 88 | Ga0466702_229701 | 3300042635 | Bacteria | 2778 |
| 89 | Ga0466722_063057 | 3300042609 | Bacteria | 3418 |
| 90 | Ga0466698_468631 | 3300042610 | Unclassified | 1169 |
| 91 | Ga0466726_173860 | 3300042619 | Bacteria | 1161 |
| 92 | Ga0123356_10017635 | 3300010049 | Bacteria | 6792 |
| 93 | Ga0123356_10327851 | 3300010049 | Bacteria | 1646 |
| 94 | Ga0123356_12051674 | 3300010049 | Bacteria | 714 |
| 95 | Ga0466694_007850 | 3300042594 | Bacteria | 1667 |
| 96 | Ga0466694_391031 | 3300042594 | Bacteria | 1715 |
| 97 | JGI24698J34947_10003272 | 3300002449 | Bacteria | 8777 |
| 98 | JGI24698J34947_10030970 | 3300002449 | Bacteria | 2818 |
| 99 | JGI24698J34947_10098123 | 3300002449 | Bacteria | 1325 |
| 100 | JGI24698J34947_10151130 | 3300002449 | Bacteria | 964 |
| 101 | Ga0072941_1000589 | 3300005201 | Bacteria | 53863 |
| 102 | Ga0072941_1024994 | 3300005201 | Bacteria | 8148 |
| 103 | Ga0072941_1046342 | 3300005201 | Bacteria | 4598 |
| 104 | Ga0466727_150207 | 3300042655 | Bacteria | 2374 |
| 105 | Ga0466727_215293 | 3300042655 | Bacteria | 1805 |
| 106 | Ga0466733_013429 | 3300042659 | Bacteria | 1073 |
| 107 | Ga0466720_026238 | 3300042607 | Bacteria | 4358 |
| 108 | Ga0466720_029857 | 3300042607 | Bacteria | 7711 |
| 109 | Ga0466712_055131 | 3300042614 | Bacteria | 19686 |
| 110 | Ga0466712_080452 | 3300042614 | Bacteria | 5157 |
| 111 | Ga0466711_183678 | 3300042615 | Bacteria | 6155 |
| 112 | Ga0466718_168403 | 3300042617 | Bacteria | 1555 |
| 113 | Ga0466726_493380 | 3300042619 | Bacteria | 2040 |
| 114 | Ga0123356_11020994 | 3300010049 | Bacteria | 997 |
| 115 | Ga0123353_10919295 | 3300010167 | Bacteria | 1188 |
| 116 | Ga0466690_360172 | 3300042590 | Bacteria | 1377 |
| 117 | Ga0466692_089696 | 3300042591 | Bacteria | 3318 |
| 118 | Ga0466694_050440 | 3300042594 | Bacteria | 148325 |
| 119 | Ga0466694_066068 | 3300042594 | Bacteria | 9756 |
| 120 | JGI24698J34947_10027594 | 3300002449 | Bacteria | 3011 |
| 121 | JGI24698J34947_10034657 | 3300002449 | Bacteria | 2639 |
| 122 | JGI24698J34947_10055159 | 3300002449 | Bacteria | 1981 |
| 123 | JGI24698J34947_10103104 | 3300002449 | Unclassified | 1277 |
| 124 | JGI24698J34947_10104521 | 3300002449 | Bacteria | 1264 |
| 125 | JGI24695J34938_10079270 | 3300002450 | Bacteria | 1359 |
| 126 | Ga0466731_390563 | 3300042622 | Bacteria | 6908 |
| 127 | Ga0466702_174067 | 3300042635 | Bacteria | 1255 |
| 128 | Ga0466727_327089 | 3300042655 | Bacteria | 3211 |
| 129 | Ga0466717_241329 | 3300042604 | Bacteria | 1558 |
| 130 | Ga0466720_035514 | 3300042607 | Bacteria | 1524 |
| 131 | Ga0466698_096540 | 3300042610 | Bacteria | 3911 |
| 132 | Ga0466698_265087 | 3300042610 | Bacteria | 3547 |
| 133 | Ga0466712_025748 | 3300042614 | Bacteria | 10768 |
| 134 | Ga0466712_276461 | 3300042614 | Bacteria | 11212 |
| 135 | Ga0466726_102923 | 3300042619 | Bacteria | 1025 |
| 136 | Ga0466726_475849 | 3300042619 | Bacteria | 1175 |
| 137 | Ga0123356_12070703 | 3300010049 | Bacteria | 710 |
| 138 | Ga0123356_14002640 | 3300010049 | Bacteria | 508 |
| 139 | Ga0123353_10757241 | 3300010167 | Bacteria | 1350 |
| 140 | Ga0466693_318071 | 3300042592 | Bacteria | 6121 |
| 141 | Ga0466694_042299 | 3300042594 | Bacteria | 1674 |
| 142 | Ga0466694_323581 | 3300042594 | Bacteria | 6647 |
| 143 | AustNasuHG_c1017439 | 3300000089 | Bacteria | 2388 |
| 144 | AustNasuHG_c1032952 | 3300000089 | Bacteria | 1422 |
| 145 | JGI24698J34947_10024542 | 3300002449 | Bacteria | 3219 |
| 146 | JGI24698J34947_10026154 | 3300002449 | Bacteria | 3102 |
| 147 | JGI24698J34947_10029604 | 3300002449 | Bacteria | 2891 |
| 148 | JGI24698J34947_10165079 | 3300002449 | Bacteria | 902 |
| 149 | Ga0466702_289804 | 3300042635 | Bacteria | 11474 |
| 150 | Ga0466733_063349 | 3300042659 | Bacteria | 2281 |
| 151 | Ga0123356_10005499 | 3300010049 | Bacteria | 12895 |
| 152 | Ga0123356_12033305 | 3300010049 | Bacteria | 717 |
| 153 | Ga0466692_131260 | 3300042591 | Bacteria | 16240 |
| 154 | Ga0466694_250467 | 3300042594 | Bacteria | 1234 |
| 155 | Ga0466694_378869 | 3300042594 | Bacteria | 2993 |
| 156 | Ga0466695_380457 | 3300042595 | Bacteria | 78840 |
| 157 | Ga0466699_188665 | 3300042597 | Bacteria | 1264 |
| 158 | AustNasuHG_c1031096 | 3300000089 | Bacteria | 1517 |
| 159 | JGI24698J34947_10105306 | 3300002449 | Bacteria | 1258 |
| 160 | JGI24698J34947_10136366 | 3300002449 | Bacteria | 1041 |
| 161 | JGI24698J34947_10163877 | 3300002449 | Unclassified | 907 |
| 162 | JGI24695J34938_10000036 | 3300002450 | Bacteria | 101915 |
| 163 | Ga0072941_1017427 | 3300005201 | Bacteria | 23253 |
| 164 | Ga0072941_1025687 | 3300005201 | Bacteria | 14903 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00392 | GntR | Bacterial regulatory proteins, gntR family | 66 | 128 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.