Protein Family IF04841
Metagenome
Isolate
222
Members
48
Samples
219
Scaffolds
333.77
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_025424|Ga0466691_025424_7199_8317
- Length
- 372 aa
- Sequence
- MYVRYTFFMNRITKNIITNYIRGRLKTVEFAITNACIAKCSFCDIWKQQPKVFVDREKALTVIDRLADFGVVHITITGGEPLLHPSIVDFVDRAASRNMHNAVLDAAPQLLMRNNIVKRLEDAGCDMISISFDSGDPVVMAESRKIPNIMDDMAKALELIGKTNITTMASVLIWNDNYDKLEEVCARAKNMGFDLVSLNYPTFSKSKVYPLGGEGISLSREKVIHGLESAIALRKTGKYGIINSPVSMRNIVNFLRDPTGAAYPCFGGRRVFFVDWFFDVRPCMQLPTVLGNMLTMKVEDLNRPPCNDCNMSWYRDFSAMLHGFKSLPVWLDSVSQTRAIQKRGKRQWYRPTPDTPQAAGPFHRSQMPPPAP
Sample Types
Isolate
1.4%
Metagenome
98.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.7%
Kalotermitidae
30.4%
Unclassified
10.9%
Rhinotermitidae
6.5%
Termopsidae
6.5%
Taxonomy
Archaea
0
Bacteria
207
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 40 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_258628 | 3300042615 | Bacteria | 13321 |
| 2 | Ga0466715_143440 | 3300042616 | Bacteria | 6912 |
| 3 | Ga0466723_040916 | 3300042618 | Bacteria | 14451 |
| 4 | Ga0466723_051693 | 3300042618 | Bacteria | 5694 |
| 5 | Ga0466723_363766 | 3300042618 | Bacteria | 3757 |
| 6 | Ga0466729_054618 | 3300042621 | Bacteria | 7909 |
| 7 | Ga0123357_10293358 | 3300009784 | Bacteria | 1657 |
| 8 | Ga0123356_10385701 | 3300010049 | Bacteria | 1535 |
| 9 | Ga0466704_045388 | 3300042643 | Bacteria | 3926 |
| 10 | Ga0466709_276108 | 3300042648 | Bacteria | 9519 |
| 11 | Ga0466708_041057 | 3300042652 | Bacteria | 6899 |
| 12 | Ga0264413_103150 | 3300024493 | Bacteria | 16485 |
| 13 | Ga0264413_113930 | 3300024493 | Unclassified | 2179 |
| 14 | Ga0264413_116745 | 3300024493 | Bacteria | 5717 |
| 15 | Ga0466691_080904 | 3300042593 | Bacteria | 6227 |
| 16 | Ga0466696_149712 | 3300042596 | Unclassified | 5363 |
| 17 | 2230969625 | 2228664004 | Bacteria | 8952 |
| 18 | Ga0072940_1006414 | 3300005200 | Unclassified | 3189 |
| 19 | Ga0466707_409563 | 3300042601 | Bacteria | 3894 |
| 20 | Ga0466716_273957 | 3300042605 | Bacteria | 3945 |
| 21 | Ga0466716_501849 | 3300042605 | Bacteria | 9343 |
| 22 | Ga0466719_239204 | 3300042606 | Bacteria | 5234 |
| 23 | Ga0466705_133558 | 3300042612 | Bacteria | 4538 |
| 24 | Ga0466705_232238 | 3300042612 | Bacteria | 14625 |
| 25 | Ga0466711_012627 | 3300042615 | Bacteria | 16808 |
| 26 | Ga0466715_643566 | 3300042616 | Bacteria | 8169 |
| 27 | Ga0466718_120898 | 3300042617 | Bacteria | 4678 |
| 28 | Ga0466723_051830 | 3300042618 | Bacteria | 14660 |
| 29 | Ga0466723_255365 | 3300042618 | Bacteria | 6033 |
| 30 | Ga0466726_198130 | 3300042619 | Bacteria | 2393 |
| 31 | Ga0466729_264040 | 3300042621 | Bacteria | 3481 |
| 32 | Ga0466703_073129 | 3300042636 | Bacteria | 3828 |
| 33 | Ga0466703_079078 | 3300042636 | Bacteria | 3508 |
| 34 | Ga0466703_189907 | 3300042636 | Bacteria | 21640 |
| 35 | Ga0466704_139785 | 3300042643 | Bacteria | 33741 |
| 36 | Ga0466690_056771 | 3300042590 | Unclassified | 3245 |
| 37 | Ga0466693_343578 | 3300042592 | Bacteria | 18737 |
| 38 | Ga0466694_088786 | 3300042594 | Bacteria | 2972 |
| 39 | Ga0466694_132747 | 3300042594 | Bacteria | 2842 |
| 40 | Ga0466696_072013 | 3300042596 | Bacteria | 2838 |
| 41 | Ga0466696_261919 | 3300042596 | Bacteria | 12385 |
| 42 | Ga0466696_445148 | 3300042596 | Bacteria | 16635 |
| 43 | Ga0466699_166572 | 3300042597 | Bacteria | 11395 |
| 44 | JGI24698J34947_10002394 | 3300002449 | Bacteria | 10095 |
| 45 | JGI24698J34947_10079414 | 3300002449 | Bacteria | 1545 |
| 46 | Ga0466707_060801 | 3300042601 | Bacteria | 1963 |
| 47 | Ga0466719_341538 | 3300042606 | Bacteria | 12093 |
| 48 | Ga0466719_446128 | 3300042606 | Unclassified | 4255 |
| 49 | Ga0466722_020678 | 3300042609 | Bacteria | 5853 |
| 50 | Ga0466732_014836 | 3300042656 | Bacteria | 2239 |
| 51 | Ga0466732_290501 | 3300042656 | Bacteria | 19092 |
| 52 | Ga0466712_005865 | 3300042614 | Bacteria | 26501 |
| 53 | Ga0466712_054130 | 3300042614 | Bacteria | 1486 |
| 54 | Ga0466715_216345 | 3300042616 | Bacteria | 1260 |
| 55 | Ga0466718_113966 | 3300042617 | Bacteria | 23122 |
| 56 | Ga0466723_092640 | 3300042618 | Bacteria | 22958 |
| 57 | Ga0466726_263676 | 3300042619 | Bacteria | 1323 |
| 58 | Ga0466726_314678 | 3300042619 | Bacteria | 7017 |
| 59 | Ga0466726_345911 | 3300042619 | Bacteria | 2049 |
| 60 | Ga0466728_123040 | 3300042620 | Bacteria | 25921 |
| 61 | Ga0466703_039767 | 3300042636 | Bacteria | 8819 |
| 62 | Ga0466704_571698 | 3300042643 | Bacteria | 11375 |
| 63 | Ga0466708_142021 | 3300042652 | Bacteria | 4192 |
| 64 | Ga0466708_256797 | 3300042652 | Bacteria | 1923 |
| 65 | Ga0264413_104472 | 3300024493 | Bacteria | 9110 |
| 66 | Ga0264413_105383 | 3300024493 | Unclassified | 11988 |
| 67 | Ga0466691_025424 | 3300042593 | Bacteria | 9668 |
| 68 | AustNasuHG_c1015622 | 3300000089 | Bacteria | 2558 |
| 69 | AustNasuHG_c1026563 | 3300000089 | Unclassified | 1801 |
| 70 | JGI24698J34947_10000099 | 3300002449 | Bacteria | 29775 |
| 71 | JGI24695J34938_10000122 | 3300002450 | Bacteria | 69892 |
| 72 | JGI24702J35022_10157458 | 3300002462 | Bacteria | 1278 |
| 73 | Ga0072940_1043529 | 3300005200 | Bacteria | 1608 |
| 74 | Ga0072941_1001626 | 3300005201 | Bacteria | 73081 |
| 75 | Ga0072941_1013975 | 3300005201 | Bacteria | 17788 |
| 76 | Ga0466716_102969 | 3300042605 | Bacteria | 1656 |
| 77 | Ga0466719_059745 | 3300042606 | Bacteria | 3453 |
| 78 | Ga0466720_017547 | 3300042607 | Bacteria | 9890 |
| 79 | Ga0466720_194801 | 3300042607 | Bacteria | 2024 |
| 80 | Ga0466732_351614 | 3300042656 | Bacteria | 2286 |
| 81 | Ga0466711_077074 | 3300042615 | Bacteria | 6161 |
| 82 | Ga0466723_247661 | 3300042618 | Bacteria | 3440 |
| 83 | Ga0466726_363947 | 3300042619 | Bacteria | 1344 |
| 84 | Ga0123353_10091152 | 3300010167 | Bacteria | 4910 |
| 85 | Ga0466735_003190 | 3300042624 | Bacteria | 1808 |
| 86 | Ga0466703_157479 | 3300042636 | Bacteria | 13671 |
| 87 | Ga0466709_097255 | 3300042648 | Bacteria | 2703 |
| 88 | Ga0466708_042362 | 3300042652 | Bacteria | 3452 |
| 89 | Ga0466708_141048 | 3300042652 | Bacteria | 4789 |
| 90 | Ga0466699_045334 | 3300042597 | Bacteria | 1394 |
| 91 | Ga0466699_060054 | 3300042597 | Bacteria | 12416 |
| 92 | JGI24698J34947_10073555 | 3300002449 | Unclassified | 1630 |
| 93 | Ga0466716_360259 | 3300042605 | Bacteria | 10623 |
| 94 | Ga0466719_221593 | 3300042606 | Bacteria | 8967 |
| 95 | Ga0466720_006821 | 3300042607 | Bacteria | 2018 |
| 96 | Ga0466705_169750 | 3300042612 | Bacteria | 3236 |
| 97 | Ga0466712_000892 | 3300042614 | Bacteria | 3952 |
| 98 | Ga0466712_121594 | 3300042614 | Bacteria | 14660 |
| 99 | Ga0466711_266605 | 3300042615 | Bacteria | 1475 |
| 100 | Ga0466718_089700 | 3300042617 | Bacteria | 4552 |
| 101 | Ga0466723_066031 | 3300042618 | Bacteria | 19644 |
| 102 | Ga0466728_075804 | 3300042620 | Bacteria | 6526 |
| 103 | Ga0466728_412768 | 3300042620 | Bacteria | 6763 |
| 104 | Ga0123357_10364143 | 3300009784 | Bacteria | 1365 |
| 105 | Ga0123354_10182767 | 3300010882 | Bacteria | 2385 |
| 106 | Ga0466704_142715 | 3300042643 | Bacteria | 13661 |
| 107 | Ga0466704_154549 | 3300042643 | Bacteria | 24370 |
| 108 | Ga0466704_335878 | 3300042643 | Bacteria | 8128 |
| 109 | Ga0466708_307854 | 3300042652 | Bacteria | 20591 |
| 110 | Ga0264413_104471 | 3300024493 | Bacteria | 10105 |
| 111 | Ga0466690_174853 | 3300042590 | Bacteria | 2821 |
| 112 | Ga0466690_299307 | 3300042590 | Bacteria | 12999 |
| 113 | Ga0466691_004530 | 3300042593 | Bacteria | 6117 |
| 114 | Ga0466695_168684 | 3300042595 | Bacteria | 1800 |
| 115 | AustNasuHG_c1014400 | 3300000089 | Bacteria | 2691 |
| 116 | JGI24698J34947_10000423 | 3300002449 | Bacteria | 19367 |
| 117 | JGI24698J34947_10000517 | 3300002449 | Unclassified | 18211 |
| 118 | JGI24698J34947_10019729 | 3300002449 | Unclassified | 3633 |
| 119 | JGI24695J34938_10000802 | 3300002450 | Bacteria | 29173 |
| 120 | JGI24695J34938_10001835 | 3300002450 | Bacteria | 17308 |
| 121 | JGI24695J34938_10002844 | 3300002450 | Bacteria | 12626 |
| 122 | JGI24702J35022_10092937 | 3300002462 | Bacteria | 1644 |
| 123 | Ga0074263_113737 | 3300005485 | Bacteria | 4131 |
| 124 | Ga0466716_064054 | 3300042605 | Bacteria | 5302 |
| 125 | Ga0466720_055524 | 3300042607 | Bacteria | 7309 |
| 126 | Ga0466698_011029 | 3300042610 | Bacteria | 1971 |
| 127 | Ga0466732_062413 | 3300042656 | Bacteria | 2542 |
| 128 | Ga0466712_006499 | 3300042614 | Unclassified | 8768 |
| 129 | Ga0466711_144997 | 3300042615 | Bacteria | 4404 |
| 130 | Ga0466718_053982 | 3300042617 | Bacteria | 10562 |
| 131 | Ga0466723_118932 | 3300042618 | Bacteria | 1847 |
| 132 | Ga0466735_231781 | 3300042624 | Unclassified | 2047 |
| 133 | Ga0466703_151321 | 3300042636 | Bacteria | 26945 |
| 134 | Ga0466704_290406 | 3300042643 | Bacteria | 19774 |
| 135 | Ga0466709_060674 | 3300042648 | Bacteria | 6886 |
| 136 | Ga0466709_308989 | 3300042648 | Bacteria | 13963 |
| 137 | Ga0466727_005789 | 3300042655 | Bacteria | 2531 |
| 138 | Ga0466727_326883 | 3300042655 | Bacteria | 13981 |
| 139 | Ga0466690_000805 | 3300042590 | Bacteria | 10725 |
| 140 | Ga0466690_178517 | 3300042590 | Bacteria | 3045 |
| 141 | Ga0466691_181694 | 3300042593 | Bacteria | 1491 |
| 142 | Ga0466694_065292 | 3300042594 | Bacteria | 1322 |
| 143 | Ga0466696_233477 | 3300042596 | Bacteria | 5015 |
| 144 | JGI24702J35022_10035191 | 3300002462 | Bacteria | 2678 |
| 145 | JGI24702J35022_10073954 | 3300002462 | Bacteria | 1839 |
| 146 | Ga0068305_10013479 | 3300005083 | Bacteria | 16490 |
| 147 | Ga0466716_185565 | 3300042605 | Bacteria | 8346 |
| 148 | Ga0466716_310967 | 3300042605 | Bacteria | 1284 |
| 149 | Ga0466716_522759 | 3300042605 | Bacteria | 4866 |
| 150 | Ga0466719_018606 | 3300042606 | Bacteria | 47371 |
| 151 | Ga0466698_028644 | 3300042610 | Bacteria | 14849 |
| 152 | Ga0466705_274490 | 3300042612 | Bacteria | 7390 |
| 153 | Ga0466705_294579 | 3300042612 | Bacteria | 6016 |
| 154 | Ga0466705_475965 | 3300042612 | Bacteria | 17846 |
| 155 | Ga0466712_085746 | 3300042614 | Bacteria | 10127 |
| 156 | Ga0466712_233282 | 3300042614 | Unclassified | 9752 |
| 157 | Ga0466711_158664 | 3300042615 | Unclassified | 3286 |
| 158 | Ga0466715_211464 | 3300042616 | Bacteria | 5767 |
| 159 | Ga0466715_217957 | 3300042616 | Bacteria | 1376 |
| 160 | Ga0466715_410680 | 3300042616 | Bacteria | 19869 |
| 161 | Ga0466715_410773 | 3300042616 | Bacteria | 11940 |
| 162 | Ga0466718_114491 | 3300042617 | Bacteria | 1413 |
| 163 | Ga0466726_259621 | 3300042619 | Bacteria | 1100 |
| 164 | Ga0466726_321238 | 3300042619 | Bacteria | 7007 |
| 165 | Ga0466726_466217 | 3300042619 | Bacteria | 19263 |
| 166 | Ga0466728_193815 | 3300042620 | Bacteria | 9800 |
| 167 | Ga0466728_218163 | 3300042620 | Bacteria | 8107 |
| 168 | Ga0123357_10019585 | 3300009784 | Bacteria | 9022 |
| 169 | Ga0123353_10166137 | 3300010167 | Bacteria | 3507 |
| 170 | Ga0466703_331847 | 3300042636 | Bacteria | 4311 |
| 171 | Ga0466709_130045 | 3300042648 | Bacteria | 9306 |
| 172 | Ga0466708_045675 | 3300042652 | Bacteria | 1587 |
| 173 | Ga0466708_077762 | 3300042652 | Bacteria | 2535 |
| 174 | Ga0466708_252933 | 3300042652 | Unclassified | 2271 |
| 175 | Ga0466708_313111 | 3300042652 | Bacteria | 2770 |
| 176 | Ga0466727_125793 | 3300042655 | Bacteria | 26855 |
| 177 | Ga0466690_067759 | 3300042590 | Bacteria | 4758 |
| 178 | Ga0466690_080805 | 3300042590 | Bacteria | 5308 |
| 179 | Ga0466692_056612 | 3300042591 | Bacteria | 14563 |
| 180 | Ga0466691_010452 | 3300042593 | Bacteria | 9411 |
| 181 | Ga0466691_143196 | 3300042593 | Bacteria | 3124 |
| 182 | Ga0466694_062007 | 3300042594 | Bacteria | 35277 |
| 183 | Ga0466696_039520 | 3300042596 | Bacteria | 3345 |
| 184 | Ga0466696_263241 | 3300042596 | Bacteria | 32707 |
| 185 | JGI24698J34947_10005736 | 3300002449 | Bacteria | 6808 |
| 186 | Ga0466707_239141 | 3300042601 | Bacteria | 1438 |
| 187 | Ga0466716_357740 | 3300042605 | Bacteria | 1324 |
| 188 | Ga0466719_375318 | 3300042606 | Bacteria | 15596 |
| 189 | Ga0466720_104753 | 3300042607 | Bacteria | 24802 |
| 190 | Ga0466722_079491 | 3300042609 | Bacteria | 30706 |
| 191 | Ga0466722_115849 | 3300042609 | Bacteria | 13635 |
| 192 | Ga0466722_147100 | 3300042609 | Bacteria | 2865 |
| 193 | Ga0466705_223498 | 3300042612 | Bacteria | 8149 |
| 194 | Ga0466712_045237 | 3300042614 | Bacteria | 2146 |
| 195 | Ga0466712_238735 | 3300042614 | Bacteria | 1275 |
| 196 | Ga0466711_143421 | 3300042615 | Bacteria | 8114 |
| 197 | Ga0466715_117639 | 3300042616 | Bacteria | 17708 |
| 198 | Ga0466715_151370 | 3300042616 | Bacteria | 3064 |
| 199 | Ga0466718_149645 | 3300042617 | Bacteria | 1873 |
| 200 | Ga0466723_211368 | 3300042618 | Bacteria | 5911 |
| 201 | Ga0466726_373215 | 3300042619 | Bacteria | 1341 |
| 202 | Ga0123353_10122807 | 3300010167 | Bacteria | 4174 |
| 203 | Ga0466731_303538 | 3300042622 | Bacteria | 1082 |
| 204 | Ga0466735_028969 | 3300042624 | Bacteria | 11964 |
| 205 | Ga0466703_422577 | 3300042636 | Bacteria | 21257 |
| 206 | Ga0466704_374483 | 3300042643 | Bacteria | 1432 |
| 207 | Ga0466708_046047 | 3300042652 | Bacteria | 17111 |
| 208 | Ga0466708_088702 | 3300042652 | Bacteria | 15123 |
| 209 | Ga0466708_443983 | 3300042652 | Bacteria | 6334 |
| 210 | Ga0466727_228421 | 3300042655 | Bacteria | 3393 |
| 211 | Ga0466691_154112 | 3300042593 | Bacteria | 40426 |
| 212 | Ga0466691_193507 | 3300042593 | Bacteria | 16403 |
| 213 | Ga0466694_223871 | 3300042594 | Bacteria | 1717 |
| 214 | Ga0466699_255434 | 3300042597 | Bacteria | 10653 |
| 215 | JGI24698J34947_10001203 | 3300002449 | Bacteria | 13522 |
| 216 | JGI24695J34938_10000260 | 3300002450 | Bacteria | 51321 |
| 217 | Ga0072940_1006417 | 3300005200 | Bacteria | 9194 |
| 218 | Ga0072941_1001982 | 3300005201 | Bacteria | 47195 |
| 219 | Ga0466720_114266 | 3300042607 | Bacteria | 1134 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04055 | Radical_SAM | Radical SAM superfamily | 32 | 185 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.