Protein Family IF04826
Metagenome
Isolate
162
Members
68
Samples
152
Scaffolds
315.14
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_016488|Ga0466691_016488_4799_5914
- Length
- 350 aa
- Sequence
- MKVRRRRKHKECIHLFQVIYYASLYAPVIFFNCLFFPVAASNFVDYVRIYCRSGNGGAGAMHLHREKFVDKGGPDHVILRGDSQHWTLIHLKYRKHIHAEDGGKGGSALSTGADGADTVLDVPLGTIARNAETGEMLFEVTAHGEKKTLVKGGRGGMGNAFFKSATNQTPRYAQPGEPCREGWFVLELKILADVGLVGLPNAGKSTLLSVVSAAKPKIADYPFTTLEPNLGIVKYRDYKSFVMADIPGIIAGASEGKGLGLRFLRHIERNAVLLFLVPADSPDVCAEYRVLLRELQRYNPEMMDKKRLLAVSKCTLPKDVPHLFFSSLTQEGVAALKDLLWKTLNEKENS
Sample Types
Isolate
6.2%
Metagenome
93.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
30.5%
Kalotermitidae
23.7%
Unclassified
6.8%
Termopsidae
6.8%
Formicidae
6.8%
Drosophilidae
5.1%
Armadillidiidae
5.1%
Rhinotermitidae
5.1%
Passalidae
3.4%
Culicidae
3.4%
Hydrophilidae
1.7%
Bombycidae
1.7%
Taxonomy
Archaea
0
Bacteria
150
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 3 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 4 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 5 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 6 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 7 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 8 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 9 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 14 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 34 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 35 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 36 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 46 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 47 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 48 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 49 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 53 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 54 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 55 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 56 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 58 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 59 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 60 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 61 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 62 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 63 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 64 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 65 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 66 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 67 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 68 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466723_219163 | 3300042618 | Bacteria | 12394 |
| 2 | Ga0466726_145590 | 3300042619 | Bacteria | 9288 |
| 3 | Ga0466728_002442 | 3300042620 | Bacteria | 4274 |
| 4 | Ga0466729_038630 | 3300042621 | Bacteria | 5286 |
| 5 | Ga0466690_341863 | 3300042590 | Bacteria | 4615 |
| 6 | Ga0466699_310702 | 3300042597 | Bacteria | 5785 |
| 7 | Ga0466719_391091 | 3300042606 | Bacteria | 3310 |
| 8 | Ga0466719_513069 | 3300042606 | Bacteria | 1143 |
| 9 | Ga0466721_069278 | 3300042608 | Bacteria | 8090 |
| 10 | Ga0466735_050828 | 3300042624 | Bacteria | 2913 |
| 11 | Ga0466704_351491 | 3300042643 | Bacteria | 49257 |
| 12 | Ga0466704_415043 | 3300042643 | Bacteria | 1325 |
| 13 | Ga0466709_162194 | 3300042648 | Bacteria | 7034 |
| 14 | Ga0466709_287029 | 3300042648 | Bacteria | 41744 |
| 15 | Ga0466708_409151 | 3300042652 | Unclassified | 4981 |
| 16 | Ga0102735_1000718 | 3300007080 | Bacteria | 7345 |
| 17 | Ga0466697_057091 | 3300042611 | Bacteria | 8269 |
| 18 | Ga0466705_134816 | 3300042612 | Bacteria | 9131 |
| 19 | Ga0123356_10043982 | 3300010049 | Bacteria | 4158 |
| 20 | Ga0123353_10001584 | 3300010167 | Bacteria | 27977 |
| 21 | Ga0123353_10045480 | 3300010167 | Bacteria | 6966 |
| 22 | Ga0123353_10206183 | 3300010167 | Unclassified | 3088 |
| 23 | Ga0123353_10350965 | 3300010167 | Bacteria | 2223 |
| 24 | Ga0466711_177939 | 3300042615 | Bacteria | 15871 |
| 25 | Ga0466723_004942 | 3300042618 | Bacteria | 30582 |
| 26 | Ga0466723_210506 | 3300042618 | Bacteria | 54048 |
| 27 | Ga0466726_457944 | 3300042619 | Unclassified | 1204 |
| 28 | Ga0160431_101395 | 3300012828 | Unclassified | 7008 |
| 29 | Ga0466690_160122 | 3300042590 | Bacteria | 11975 |
| 30 | Ga0466696_086263 | 3300042596 | Bacteria | 12874 |
| 31 | Ga0466696_481040 | 3300042596 | Bacteria | 2886 |
| 32 | Ga0466716_297779 | 3300042605 | Bacteria | 3575 |
| 33 | Ga0466722_059928 | 3300042609 | Bacteria | 3406 |
| 34 | Ga0466734_039355 | 3300042623 | Bacteria | 1409 |
| 35 | Ga0466703_267412 | 3300042636 | Bacteria | 5394 |
| 36 | Ga0466724_08055 | 3300042649 | Unclassified | 2816 |
| 37 | Ga0466708_039878 | 3300042652 | Bacteria | 12578 |
| 38 | Ga0466727_011196 | 3300042655 | Bacteria | 9723 |
| 39 | JGI24702J35022_10000206 | 3300002462 | Bacteria | 32370 |
| 40 | CVPL010W_10002402 | 3300002931 | Bacteria | 21983 |
| 41 | Ga0072941_1077263 | 3300005201 | Bacteria | 3852 |
| 42 | Ga0103267_1000036 | 3300007190 | Bacteria | 58694 |
| 43 | Ga0123356_10316504 | 3300010049 | Bacteria | 1672 |
| 44 | Ga0123354_10048332 | 3300010882 | Bacteria | 6471 |
| 45 | Ga0123354_10106331 | 3300010882 | Bacteria | 3746 |
| 46 | Ga0466711_226790 | 3300042615 | Bacteria | 8257 |
| 47 | Ga0466718_038924 | 3300042617 | Bacteria | 3787 |
| 48 | Ga0466723_005119 | 3300042618 | Bacteria | 4041 |
| 49 | Ga0466723_251372 | 3300042618 | Bacteria | 8326 |
| 50 | Ga0466726_142050 | 3300042619 | Bacteria | 3097 |
| 51 | Ga0466728_180096 | 3300042620 | Bacteria | 1190 |
| 52 | Ga0466692_168883 | 3300042591 | Bacteria | 9822 |
| 53 | Ga0466691_016488 | 3300042593 | Bacteria | 10071 |
| 54 | Ga0466696_244978 | 3300042596 | Bacteria | 67990 |
| 55 | Ga0466699_267798 | 3300042597 | Unclassified | 1485 |
| 56 | Ga0466700_188753 | 3300042600 | Bacteria | 2479 |
| 57 | Ga0466707_307638 | 3300042601 | Bacteria | 1108 |
| 58 | Ga0466716_072533 | 3300042605 | Bacteria | 7703 |
| 59 | Ga0466722_104502 | 3300042609 | Bacteria | 8364 |
| 60 | Ga0466722_120746 | 3300042609 | Bacteria | 7217 |
| 61 | Ga0466722_155124 | 3300042609 | Bacteria | 4964 |
| 62 | Ga0466722_197152 | 3300042609 | Bacteria | 14286 |
| 63 | Ga0466698_094137 | 3300042610 | Bacteria | 2368 |
| 64 | Ga0466709_204440 | 3300042648 | Bacteria | 87623 |
| 65 | Ga0466727_040552 | 3300042655 | Bacteria | 9696 |
| 66 | Ga0104048_1001865 | 3300007143 | Unclassified | 7309 |
| 67 | Ga0466732_391036 | 3300042656 | Bacteria | 4178 |
| 68 | Ga0466711_088394 | 3300042615 | Bacteria | 6324 |
| 69 | Ga0466711_171503 | 3300042615 | Bacteria | 16708 |
| 70 | Ga0466715_040991 | 3300042616 | Bacteria | 6773 |
| 71 | Ga0466723_083200 | 3300042618 | Bacteria | 3677 |
| 72 | Ga0160453_100001 | 3300012814 | Bacteria | 1272344 |
| 73 | Ga0466690_057250 | 3300042590 | Bacteria | 4769 |
| 74 | Ga0466696_069308 | 3300042596 | Bacteria | 12314 |
| 75 | Ga0466716_281639 | 3300042605 | Bacteria | 4912 |
| 76 | Ga0068302_10146618 | 3300005071 | Bacteria | 1684 |
| 77 | Ga0072941_1062774 | 3300005201 | Bacteria | 6242 |
| 78 | Ga0104050_1004400 | 3300007153 | Bacteria | 25578 |
| 79 | Ga0466697_104570 | 3300042611 | Bacteria | 1352 |
| 80 | Ga0466711_218446 | 3300042615 | Bacteria | 9822 |
| 81 | Ga0466718_154896 | 3300042617 | Bacteria | 2070 |
| 82 | Ga0466723_071771 | 3300042618 | Bacteria | 6044 |
| 83 | Ga0466726_317131 | 3300042619 | Bacteria | 5773 |
| 84 | Ga0466728_111518 | 3300042620 | Bacteria | 9204 |
| 85 | Ga0160456_100088 | 3300012820 | Bacteria | 116871 |
| 86 | Ga0466690_042308 | 3300042590 | Bacteria | 10596 |
| 87 | Ga0466692_176604 | 3300042591 | Bacteria | 3992 |
| 88 | Ga0466691_011801 | 3300042593 | Bacteria | 8506 |
| 89 | Ga0466701_072239 | 3300042598 | Bacteria | 2364 |
| 90 | Ga0466719_163176 | 3300042606 | Unclassified | 10940 |
| 91 | Ga0466727_025948 | 3300042655 | Bacteria | 9440 |
| 92 | IMNBL1DRAFT_c0000172 | 3300000062 | Bacteria | 58110 |
| 93 | IMNBL1DRAFT_c0018514 | 3300000062 | Bacteria | 2892 |
| 94 | Ga0072940_1292414 | 3300005200 | Bacteria | 1226 |
| 95 | Ga0104019_1002140 | 3300007150 | Bacteria | 4404 |
| 96 | Ga0103267_1000058 | 3300007190 | Bacteria | 85745 |
| 97 | Ga0123353_10003260 | 3300010167 | Bacteria | 20476 |
| 98 | Ga0123354_10082982 | 3300010882 | Bacteria | 4514 |
| 99 | Ga0123354_10269183 | 3300010882 | Bacteria | 1681 |
| 100 | Ga0160465_100011 | 3300012803 | Bacteria | 346564 |
| 101 | Ga0466723_054878 | 3300042618 | Bacteria | 53248 |
| 102 | Ga0466723_141613 | 3300042618 | Bacteria | 10974 |
| 103 | Ga0466728_008202 | 3300042620 | Bacteria | 7566 |
| 104 | Ga0466690_067878 | 3300042590 | Bacteria | 5368 |
| 105 | Ga0466690_365297 | 3300042590 | Bacteria | 13158 |
| 106 | Ga0466701_010527 | 3300042598 | Bacteria | 1888 |
| 107 | Ga0466735_009858 | 3300042624 | Bacteria | 3556 |
| 108 | Ga0466703_159189 | 3300042636 | Unclassified | 1851 |
| 109 | Ga0466724_23132 | 3300042649 | Unclassified | 3154 |
| 110 | Ga0466724_65356 | 3300042649 | Bacteria | 5669 |
| 111 | Ga0466708_130740 | 3300042652 | Bacteria | 21643 |
| 112 | Ga0466708_238469 | 3300042652 | Bacteria | 6290 |
| 113 | 2227330772 | 2225789004 | Bacteria | 28934 |
| 114 | Ga0123356_10000726 | 3300010049 | Bacteria | 36353 |
| 115 | Ga0123353_10004501 | 3300010167 | Bacteria | 17952 |
| 116 | Ga0123353_10636805 | 3300010167 | Bacteria | 1513 |
| 117 | Ga0123354_10046224 | 3300010882 | Bacteria | 6654 |
| 118 | Ga0466712_118189 | 3300042614 | Bacteria | 22024 |
| 119 | Ga0466728_102471 | 3300042620 | Bacteria | 3623 |
| 120 | Ga0466728_132211 | 3300042620 | Bacteria | 29619 |
| 121 | Ga0160470_100525 | 3300012813 | Bacteria | 15116 |
| 122 | Ga0160455_100258 | 3300012837 | Bacteria | 39853 |
| 123 | Ga0160457_1003138 | 3300012858 | Bacteria | 3002 |
| 124 | Ga0466690_421855 | 3300042590 | Bacteria | 12532 |
| 125 | Ga0466696_075284 | 3300042596 | Bacteria | 3481 |
| 126 | Ga0466701_036354 | 3300042598 | Bacteria | 4863 |
| 127 | Ga0466701_072449 | 3300042598 | Bacteria | 2203 |
| 128 | Ga0466716_178418 | 3300042605 | Bacteria | 12563 |
| 129 | Ga0466719_265093 | 3300042606 | Bacteria | 4600 |
| 130 | Ga0466734_013372 | 3300042623 | Bacteria | 1080 |
| 131 | Ga0466703_281572 | 3300042636 | Bacteria | 12329 |
| 132 | Ga0466708_192538 | 3300042652 | Bacteria | 3408 |
| 133 | Ga0068302_10231922 | 3300005071 | Bacteria | 2185 |
| 134 | Ga0103268_1000138 | 3300007192 | Bacteria | 24170 |
| 135 | Ga0466697_057500 | 3300042611 | Bacteria | 2211 |
| 136 | Ga0466733_054890 | 3300042659 | Bacteria | 1976 |
| 137 | Ga0466733_104875 | 3300042659 | Bacteria | 10917 |
| 138 | Ga0466715_188508 | 3300042616 | Bacteria | 13972 |
| 139 | Ga0466723_128705 | 3300042618 | Bacteria | 25504 |
| 140 | Ga0466729_162344 | 3300042621 | Bacteria | 1459 |
| 141 | Ga0160447_100023 | 3300012849 | Bacteria | 248054 |
| 142 | Ga0466696_013496 | 3300042596 | Bacteria | 2306 |
| 143 | Ga0466696_025664 | 3300042596 | Bacteria | 5987 |
| 144 | Ga0466699_059379 | 3300042597 | Bacteria | 3659 |
| 145 | Ga0466719_352545 | 3300042606 | Bacteria | 10649 |
| 146 | Ga0466735_037885 | 3300042624 | Bacteria | 6680 |
| 147 | Ga0466703_204210 | 3300042636 | Unclassified | 5682 |
| 148 | Ga0466703_227030 | 3300042636 | Bacteria | 1486 |
| 149 | Ga0466724_50758 | 3300042649 | Unclassified | 1010 |
| 150 | IMNBL1DRAFT_c0013210 | 3300000062 | Bacteria | 3722 |
| 151 | JGI24705J35276_12233323 | 3300002504 | Bacteria | 4776 |
| 152 | Ga0104050_1002271 | 3300007153 | Bacteria | 7756 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02421 | GO:0005525 | GTP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.