Protein Family IF04724
Metagenome
Isolate
178
Members
40
Samples
176
Scaffolds
212.36
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_184967|Ga0466692_184967_1487_2182
- Length
- 231 aa
- Sequence
- MVYNKVKEVKSMNTRIMFLEELNRLRHDILAMATHVEEDLGKARDALRNNDAELAKEVRAGDAVVNAMQLKIEDEAAVVIATQQPVARDLRELVTIFKLTGNIERIGDHAAHLAKAAIKFSKGEASFGSLEHLERMAETGQQMLRAAISAYLAQDAESARKAAGMDNTIDSEHKALTEEVLSLMKEHPGMIKKAVRILNTSNQLERMGDHITNICEAIIYMTEGRHEELNE
Sample Types
Isolate
1.1%
Metagenome
98.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.3%
Kalotermitidae
35.9%
Rhinotermitidae
7.7%
Unclassified
2.6%
Blaberidae
2.6%
Taxonomy
Archaea
0
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 3 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 4 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 27 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 35 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 40 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_119435 | 3300042656 | Bacteria | 12278 |
| 2 | Ga0466716_082313 | 3300042605 | Bacteria | 11294 |
| 3 | Ga0466719_285965 | 3300042606 | Bacteria | 4271 |
| 4 | Ga0466722_111583 | 3300042609 | Bacteria | 1458 |
| 5 | Ga0466722_192619 | 3300042609 | Bacteria | 53930 |
| 6 | Ga0466712_059856 | 3300042614 | Bacteria | 35187 |
| 7 | Ga0466723_197611 | 3300042618 | Bacteria | 6099 |
| 8 | Ga0123356_10426367 | 3300010049 | Bacteria | 1470 |
| 9 | Ga0466692_079034 | 3300042591 | Bacteria | 2278 |
| 10 | Ga0466699_018942 | 3300042597 | Bacteria | 7215 |
| 11 | Ga0466699_062461 | 3300042597 | Unclassified | 3000 |
| 12 | Ga0466699_308758 | 3300042597 | Bacteria | 16034 |
| 13 | AustNasuHG_c1003038 | 3300000089 | Bacteria | 6051 |
| 14 | JGI24698J34947_10012147 | 3300002449 | Unclassified | 4726 |
| 15 | JGI24695J34938_10029978 | 3300002450 | Bacteria | 2539 |
| 16 | Ga0466709_388417 | 3300042648 | Bacteria | 2075 |
| 17 | Ga0466709_399159 | 3300042648 | Bacteria | 12243 |
| 18 | Ga0466708_146826 | 3300042652 | Bacteria | 14862 |
| 19 | Ga0466732_117827 | 3300042656 | Bacteria | 5106 |
| 20 | Ga0466719_270222 | 3300042606 | Bacteria | 1359 |
| 21 | Ga0466719_304184 | 3300042606 | Bacteria | 2891 |
| 22 | Ga0466719_472583 | 3300042606 | Unclassified | 1261 |
| 23 | Ga0466722_080163 | 3300042609 | Bacteria | 3569 |
| 24 | Ga0466722_133430 | 3300042609 | Bacteria | 12076 |
| 25 | Ga0466712_067293 | 3300042614 | Bacteria | 25815 |
| 26 | Ga0466711_103257 | 3300042615 | Bacteria | 20144 |
| 27 | Ga0466715_027130 | 3300042616 | Bacteria | 8746 |
| 28 | Ga0123356_10591441 | 3300010049 | Bacteria | 1274 |
| 29 | Ga0466690_139410 | 3300042590 | Bacteria | 6670 |
| 30 | Ga0466692_102552 | 3300042591 | Bacteria | 3300 |
| 31 | Ga0466696_126903 | 3300042596 | Bacteria | 19136 |
| 32 | Ga0466703_172054 | 3300042636 | Bacteria | 27282 |
| 33 | Ga0466704_088627 | 3300042643 | Bacteria | 5047 |
| 34 | Ga0466704_432140 | 3300042643 | Bacteria | 7677 |
| 35 | Ga0466732_222390 | 3300042656 | Bacteria | 3719 |
| 36 | Ga0466719_245470 | 3300042606 | Bacteria | 1529 |
| 37 | Ga0466722_063696 | 3300042609 | Bacteria | 1784 |
| 38 | Ga0466712_067938 | 3300042614 | Bacteria | 5823 |
| 39 | Ga0466711_472287 | 3300042615 | Bacteria | 15796 |
| 40 | Ga0466715_052176 | 3300042616 | Bacteria | 5005 |
| 41 | Ga0466715_274445 | 3300042616 | Bacteria | 3193 |
| 42 | Ga0466718_033700 | 3300042617 | Bacteria | 1032 |
| 43 | Ga0466718_167739 | 3300042617 | Bacteria | 4876 |
| 44 | Ga0466723_077145 | 3300042618 | Bacteria | 54484 |
| 45 | Ga0466723_086207 | 3300042618 | Bacteria | 8968 |
| 46 | Ga0466723_304137 | 3300042618 | Unclassified | 3377 |
| 47 | Ga0466729_065851 | 3300042621 | Bacteria | 1218 |
| 48 | Ga0123353_10536539 | 3300010167 | Bacteria | 1692 |
| 49 | Ga0466690_318095 | 3300042590 | Bacteria | 3350 |
| 50 | Ga0466692_047548 | 3300042591 | Bacteria | 2234 |
| 51 | Ga0466692_180756 | 3300042591 | Bacteria | 1914 |
| 52 | Ga0466696_077768 | 3300042596 | Bacteria | 1244 |
| 53 | Ga0072940_1024021 | 3300005200 | Bacteria | 7383 |
| 54 | Ga0072940_1028410 | 3300005200 | Bacteria | 4613 |
| 55 | Ga0072941_1002429 | 3300005201 | Bacteria | 39736 |
| 56 | Ga0072941_1018360 | 3300005201 | Bacteria | 13367 |
| 57 | Ga0074263_113012 | 3300005485 | Unclassified | 2399 |
| 58 | Ga0466705_355023 | 3300042612 | Bacteria | 33559 |
| 59 | Ga0466708_141548 | 3300042652 | Bacteria | 5326 |
| 60 | Ga0466708_363104 | 3300042652 | Bacteria | 7617 |
| 61 | Ga0466719_073418 | 3300042606 | Bacteria | 18332 |
| 62 | Ga0466719_145662 | 3300042606 | Unclassified | 1490 |
| 63 | Ga0466722_132303 | 3300042609 | Bacteria | 1100 |
| 64 | Ga0466712_255203 | 3300042614 | Unclassified | 1409 |
| 65 | Ga0466715_072755 | 3300042616 | Bacteria | 13115 |
| 66 | Ga0466715_282385 | 3300042616 | Bacteria | 5815 |
| 67 | Ga0466715_528583 | 3300042616 | Bacteria | 2270 |
| 68 | Ga0466723_220636 | 3300042618 | Bacteria | 5699 |
| 69 | Ga0466723_301569 | 3300042618 | Bacteria | 4020 |
| 70 | Ga0466728_335574 | 3300042620 | Bacteria | 3532 |
| 71 | Ga0415639_258363 | 3300038395 | Bacteria | 1421 |
| 72 | Ga0466694_088374 | 3300042594 | Bacteria | 2803 |
| 73 | Ga0466694_118113 | 3300042594 | Bacteria | 18792 |
| 74 | Ga0466699_008027 | 3300042597 | Bacteria | 2385 |
| 75 | Ga0072941_1004527 | 3300005201 | Bacteria | 14691 |
| 76 | Ga0466705_004837 | 3300042612 | Bacteria | 4216 |
| 77 | Ga0466705_154636 | 3300042612 | Bacteria | 11383 |
| 78 | Ga0466703_388289 | 3300042636 | Bacteria | 1827 |
| 79 | Ga0466704_049924 | 3300042643 | Bacteria | 1795 |
| 80 | Ga0466704_146694 | 3300042643 | Bacteria | 25254 |
| 81 | Ga0466709_293807 | 3300042648 | Bacteria | 6894 |
| 82 | Ga0466716_246398 | 3300042605 | Bacteria | 5630 |
| 83 | Ga0466716_420032 | 3300042605 | Bacteria | 2399 |
| 84 | Ga0466719_286132 | 3300042606 | Bacteria | 1315 |
| 85 | Ga0466720_080343 | 3300042607 | Bacteria | 15819 |
| 86 | Ga0466720_115567 | 3300042607 | Bacteria | 8267 |
| 87 | Ga0466705_466062 | 3300042612 | Bacteria | 5833 |
| 88 | Ga0466712_183286 | 3300042614 | Bacteria | 15136 |
| 89 | Ga0466711_020763 | 3300042615 | Bacteria | 11996 |
| 90 | Ga0466715_038219 | 3300042616 | Bacteria | 2693 |
| 91 | Ga0466715_192446 | 3300042616 | Bacteria | 4309 |
| 92 | Ga0466715_568937 | 3300042616 | Bacteria | 4513 |
| 93 | Ga0466718_037031 | 3300042617 | Bacteria | 1780 |
| 94 | Ga0466728_124025 | 3300042620 | Bacteria | 2568 |
| 95 | Ga0466690_070451 | 3300042590 | Bacteria | 8081 |
| 96 | Ga0466691_081910 | 3300042593 | Bacteria | 24279 |
| 97 | Ga0466691_224945 | 3300042593 | Bacteria | 3055 |
| 98 | Ga0466696_209483 | 3300042596 | Bacteria | 5965 |
| 99 | Ga0466699_158404 | 3300042597 | Bacteria | 11932 |
| 100 | JGI24698J34947_10106356 | 3300002449 | Unclassified | 1248 |
| 101 | JGI24695J34938_10009709 | 3300002450 | Bacteria | 5332 |
| 102 | JGI24702J35022_10174553 | 3300002462 | Bacteria | 1217 |
| 103 | Ga0072941_1024616 | 3300005201 | Bacteria | 11611 |
| 104 | Ga0074263_113014 | 3300005485 | Bacteria | 4185 |
| 105 | Ga0466703_085854 | 3300042636 | Bacteria | 15833 |
| 106 | Ga0466708_121373 | 3300042652 | Bacteria | 47625 |
| 107 | Ga0466708_408137 | 3300042652 | Bacteria | 19449 |
| 108 | Ga0466719_409749 | 3300042606 | Bacteria | 4976 |
| 109 | Ga0466720_165624 | 3300042607 | Bacteria | 2393 |
| 110 | Ga0466722_008102 | 3300042609 | Bacteria | 6990 |
| 111 | Ga0466698_086758 | 3300042610 | Bacteria | 1023 |
| 112 | Ga0466712_174555 | 3300042614 | Bacteria | 1172 |
| 113 | Ga0466715_097562 | 3300042616 | Bacteria | 17929 |
| 114 | Ga0466715_287907 | 3300042616 | Bacteria | 10703 |
| 115 | Ga0123356_11230483 | 3300010049 | Bacteria | 914 |
| 116 | Ga0123356_11367028 | 3300010049 | Bacteria | 870 |
| 117 | Ga0466691_189134 | 3300042593 | Bacteria | 9478 |
| 118 | Ga0466694_003244 | 3300042594 | Bacteria | 4320 |
| 119 | Ga0466699_438711 | 3300042597 | Bacteria | 7936 |
| 120 | JGI24698J34947_10068419 | 3300002449 | Bacteria | 1718 |
| 121 | JGI24695J34938_10000164 | 3300002450 | Bacteria | 61824 |
| 122 | JGI24702J35022_10005159 | 3300002462 | Bacteria | 7663 |
| 123 | Ga0074263_113013 | 3300005485 | Unclassified | 2245 |
| 124 | Ga0466705_292187 | 3300042612 | Bacteria | 13639 |
| 125 | Ga0466705_332855 | 3300042612 | Bacteria | 2663 |
| 126 | Ga0466705_375820 | 3300042612 | Bacteria | 3011 |
| 127 | Ga0466730_000581 | 3300042625 | Bacteria | 1926 |
| 128 | Ga0466703_341602 | 3300042636 | Bacteria | 3542 |
| 129 | Ga0466704_153406 | 3300042643 | Bacteria | 40156 |
| 130 | Ga0466704_610778 | 3300042643 | Bacteria | 20198 |
| 131 | Ga0466708_014166 | 3300042652 | Bacteria | 1131 |
| 132 | Ga0466708_322716 | 3300042652 | Bacteria | 5003 |
| 133 | Ga0466716_427242 | 3300042605 | Bacteria | 4217 |
| 134 | Ga0466716_475836 | 3300042605 | Bacteria | 4265 |
| 135 | Ga0466722_183458 | 3300042609 | Bacteria | 3620 |
| 136 | Ga0466712_316419 | 3300042614 | Bacteria | 2931 |
| 137 | Ga0466711_139245 | 3300042615 | Bacteria | 6095 |
| 138 | Ga0466718_045669 | 3300042617 | Bacteria | 6335 |
| 139 | Ga0466723_011828 | 3300042618 | Bacteria | 25104 |
| 140 | Ga0466723_070781 | 3300042618 | Bacteria | 1755 |
| 141 | Ga0466723_295706 | 3300042618 | Unclassified | 1311 |
| 142 | Ga0466728_025076 | 3300042620 | Bacteria | 15424 |
| 143 | Ga0466728_334605 | 3300042620 | Bacteria | 3203 |
| 144 | Ga0466690_173291 | 3300042590 | Bacteria | 3283 |
| 145 | Ga0466690_183149 | 3300042590 | Bacteria | 2964 |
| 146 | Ga0466692_184967 | 3300042591 | Bacteria | 10174 |
| 147 | Ga0466692_191536 | 3300042591 | Bacteria | 1350 |
| 148 | AustNasuHG_c1000144 | 3300000089 | Bacteria | 22319 |
| 149 | JGI24698J34947_10060383 | 3300002449 | Unclassified | 1870 |
| 150 | Ga0072941_1002394 | 3300005201 | Bacteria | 13768 |
| 151 | Ga0072941_1079149 | 3300005201 | Unclassified | 3150 |
| 152 | Ga0466705_094242 | 3300042612 | Bacteria | 12722 |
| 153 | Ga0466731_395499 | 3300042622 | Bacteria | 1714 |
| 154 | Ga0466704_091719 | 3300042643 | Unclassified | 3045 |
| 155 | Ga0466704_195103 | 3300042643 | Bacteria | 2855 |
| 156 | Ga0466704_583036 | 3300042643 | Bacteria | 6428 |
| 157 | Ga0466709_261950 | 3300042648 | Bacteria | 34221 |
| 158 | Ga0466719_510064 | 3300042606 | Bacteria | 1576 |
| 159 | Ga0466721_023390 | 3300042608 | Bacteria | 3898 |
| 160 | Ga0466722_008974 | 3300042609 | Bacteria | 1585 |
| 161 | Ga0466712_080305 | 3300042614 | Bacteria | 14846 |
| 162 | Ga0466712_126018 | 3300042614 | Bacteria | 1241 |
| 163 | Ga0466712_319512 | 3300042614 | Bacteria | 9452 |
| 164 | Ga0466715_199098 | 3300042616 | Bacteria | 46326 |
| 165 | Ga0466723_090402 | 3300042618 | Bacteria | 3104 |
| 166 | Ga0466723_179696 | 3300042618 | Bacteria | 6730 |
| 167 | Ga0466692_117954 | 3300042591 | Bacteria | 22085 |
| 168 | Ga0466691_022868 | 3300042593 | Bacteria | 2182 |
| 169 | Ga0466695_068957 | 3300042595 | Bacteria | 62949 |
| 170 | JGI24698J34947_10015578 | 3300002449 | Bacteria | 4139 |
| 171 | JGI24698J34947_10064782 | 3300002449 | Bacteria | 1784 |
| 172 | Ga0072941_1009285 | 3300005201 | Bacteria | 25402 |
| 173 | Ga0466731_269229 | 3300042622 | Bacteria | 2198 |
| 174 | Ga0466703_125253 | 3300042636 | Bacteria | 15188 |
| 175 | Ga0466708_095888 | 3300042652 | Bacteria | 1260 |
| 176 | Ga0466708_220298 | 3300042652 | Bacteria | 2428 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01895 | PhoU | PhoU domain | 30 | 116 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.