Protein Family IF04682
Metagenome
Isolate
229
Members
58
Samples
220
Scaffolds
209.25
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_120800|Ga0466692_120800_106_783
- Length
- 225 aa
- Sequence
- VGLPYNKVGEKMTIRREMTKNPVCARPEMSLNECRDIMDREKINRMPVLDKNGNLAGIITRKDLIKAGPSPATTLDIYEISWLLSKLKVEKVMVKDVITVDENEVVEEAARIMADKGIGCLPVMKGSLLVGIITDTDLFHVFVNAFGARHTGVRLTISMGEHPGQIAKVSGAIAEKGGNIVSLVTSEGDDVAHRRATLKVEGITRSEAETIIKGFADITLEDIRE
Sample Types
Isolate
3.9%
Metagenome
96.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.4%
Kalotermitidae
24.6%
Unclassified
15.8%
Termopsidae
5.3%
Rhinotermitidae
5.3%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
220
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 4 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 5 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 6 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 7 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 12 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 13 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 14 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 19 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 28 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 29 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 41 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 42 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 47 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 48 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 49 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 50 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 51 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 52 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 53 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 54 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 55 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 56 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 57 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 58 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10030076 | 3300002449 | Bacteria | 2866 |
| 2 | JGI24698J34947_10038036 | 3300002449 | Bacteria | 2497 |
| 3 | JGI24695J34938_10001411 | 3300002450 | Bacteria | 20486 |
| 4 | Ga0123356_10016574 | 3300010049 | Bacteria | 7027 |
| 5 | Ga0123356_10499062 | 3300010049 | Bacteria | 1373 |
| 6 | Ga0123353_10183833 | 3300010167 | Bacteria | 3307 |
| 7 | Ga0123354_10214981 | 3300010882 | Bacteria | 2063 |
| 8 | Ga0123354_10458204 | 3300010882 | Bacteria | 1027 |
| 9 | Ga0466718_115419 | 3300042617 | Bacteria | 1008 |
| 10 | Ga0466726_099738 | 3300042619 | Bacteria | 10128 |
| 11 | Ga0466728_031917 | 3300042620 | Bacteria | 14815 |
| 12 | Ga0466728_135923 | 3300042620 | Bacteria | 15304 |
| 13 | Ga0466690_206269 | 3300042590 | Unclassified | 1886 |
| 14 | Ga0466690_382837 | 3300042590 | Bacteria | 6104 |
| 15 | Ga0466692_156363 | 3300042591 | Bacteria | 5491 |
| 16 | Ga0466692_177153 | 3300042591 | Bacteria | 3099 |
| 17 | Ga0466692_186339 | 3300042591 | Unclassified | 1297 |
| 18 | Ga0466691_138283 | 3300042593 | Bacteria | 3490 |
| 19 | Ga0466691_152311 | 3300042593 | Bacteria | 9060 |
| 20 | Ga0466694_068273 | 3300042594 | Bacteria | 2603 |
| 21 | Ga0466699_265737 | 3300042597 | Bacteria | 2169 |
| 22 | Ga0466735_063469 | 3300042624 | Bacteria | 5850 |
| 23 | Ga0466704_087893 | 3300042643 | Bacteria | 5700 |
| 24 | Ga0466709_096306 | 3300042648 | Bacteria | 1572 |
| 25 | Ga0466708_060787 | 3300042652 | Bacteria | 11369 |
| 26 | Ga0466727_191516 | 3300042655 | Bacteria | 1461 |
| 27 | Ga0466727_245043 | 3300042655 | Unclassified | 1498 |
| 28 | Ga0466727_303150 | 3300042655 | Bacteria | 7333 |
| 29 | Ga0466700_447981 | 3300042600 | Bacteria | 2274 |
| 30 | Ga0466717_223862 | 3300042604 | Bacteria | 1149 |
| 31 | Ga0466716_238682 | 3300042605 | Bacteria | 13996 |
| 32 | Ga0466719_070715 | 3300042606 | Bacteria | 1201 |
| 33 | Ga0466722_006061 | 3300042609 | Bacteria | 1503 |
| 34 | Ga0466722_122446 | 3300042609 | Bacteria | 10691 |
| 35 | Ga0466698_262055 | 3300042610 | Bacteria | 4870 |
| 36 | Ga0466705_321325 | 3300042612 | Bacteria | 10416 |
| 37 | Ga0466733_037788 | 3300042659 | Bacteria | 3692 |
| 38 | AustNasuHG_c1000442 | 3300000089 | Bacteria | 14523 |
| 39 | JGI24702J35022_10002389 | 3300002462 | Bacteria | 11487 |
| 40 | JGI24696J40584_12921762 | 3300002834 | Bacteria | 1357 |
| 41 | Ga0123356_10967533 | 3300010049 | Bacteria | 1022 |
| 42 | Ga0123353_11609003 | 3300010167 | Bacteria | 820 |
| 43 | Ga0466711_017640 | 3300042615 | Bacteria | 5281 |
| 44 | Ga0466711_074170 | 3300042615 | Bacteria | 5833 |
| 45 | Ga0466715_031524 | 3300042616 | Bacteria | 20895 |
| 46 | Ga0466718_098640 | 3300042617 | Bacteria | 1174 |
| 47 | Ga0466723_015134 | 3300042618 | Bacteria | 10288 |
| 48 | Ga0466723_128869 | 3300042618 | Bacteria | 3445 |
| 49 | Ga0466726_285654 | 3300042619 | Bacteria | 2554 |
| 50 | Ga0466694_028462 | 3300042594 | Bacteria | 1779 |
| 51 | Ga0466694_105040 | 3300042594 | Bacteria | 1354 |
| 52 | Ga0466694_307508 | 3300042594 | Bacteria | 1681 |
| 53 | Ga0466699_069761 | 3300042597 | Bacteria | 8502 |
| 54 | Ga0466703_022028 | 3300042636 | Bacteria | 12366 |
| 55 | Ga0466727_340445 | 3300042655 | Bacteria | 3425 |
| 56 | Ga0466716_182016 | 3300042605 | Bacteria | 1318 |
| 57 | Ga0466716_414102 | 3300042605 | Bacteria | 2449 |
| 58 | Ga0466719_314418 | 3300042606 | Bacteria | 3612 |
| 59 | Ga0466719_493309 | 3300042606 | Bacteria | 1353 |
| 60 | Ga0466722_154277 | 3300042609 | Bacteria | 20249 |
| 61 | Ga0466732_044183 | 3300042656 | Bacteria | 21422 |
| 62 | Ga0072941_1001954 | 3300005201 | Bacteria | 13981 |
| 63 | Ga0072941_1007506 | 3300005201 | Bacteria | 17619 |
| 64 | Ga0123357_10012898 | 3300009784 | Bacteria | 10799 |
| 65 | Ga0123356_10445173 | 3300010049 | Bacteria | 1442 |
| 66 | Ga0123353_10119058 | 3300010167 | Bacteria | 4247 |
| 67 | Ga0123353_10730402 | 3300010167 | Bacteria | 1383 |
| 68 | Ga0466712_281066 | 3300042614 | Bacteria | 4804 |
| 69 | Ga0466711_381063 | 3300042615 | Bacteria | 1536 |
| 70 | Ga0466715_277014 | 3300042616 | Bacteria | 2922 |
| 71 | Ga0466715_559985 | 3300042616 | Bacteria | 52926 |
| 72 | Ga0466718_145497 | 3300042617 | Bacteria | 6136 |
| 73 | Ga0466723_075462 | 3300042618 | Bacteria | 18487 |
| 74 | Ga0466726_145330 | 3300042619 | Bacteria | 7033 |
| 75 | Ga0466690_413721 | 3300042590 | Bacteria | 7303 |
| 76 | Ga0466692_041599 | 3300042591 | Bacteria | 8024 |
| 77 | Ga0466692_120800 | 3300042591 | Bacteria | 1653 |
| 78 | Ga0466692_145343 | 3300042591 | Bacteria | 3893 |
| 79 | Ga0466701_009335 | 3300042598 | Bacteria | 1277 |
| 80 | Ga0466729_259576 | 3300042621 | Bacteria | 2955 |
| 81 | Ga0466735_138455 | 3300042624 | Bacteria | 1142 |
| 82 | Ga0466702_443189 | 3300042635 | Bacteria | 2065 |
| 83 | Ga0466708_429676 | 3300042652 | Bacteria | 6365 |
| 84 | Ga0466707_384317 | 3300042601 | Bacteria | 12143 |
| 85 | Ga0466719_144269 | 3300042606 | Bacteria | 7254 |
| 86 | Ga0466719_209440 | 3300042606 | Bacteria | 6116 |
| 87 | Ga0466720_010915 | 3300042607 | Bacteria | 20373 |
| 88 | Ga0466698_093715 | 3300042610 | Bacteria | 1077 |
| 89 | JGI24698J34947_10019730 | 3300002449 | Bacteria | 3633 |
| 90 | JGI24695J34938_10004667 | 3300002450 | Bacteria | 8897 |
| 91 | Ga0123356_10330023 | 3300010049 | Bacteria | 1642 |
| 92 | Ga0123353_10454931 | 3300010167 | Bacteria | 1883 |
| 93 | Ga0466710_202832 | 3300042613 | Bacteria | 1051 |
| 94 | Ga0466712_137162 | 3300042614 | Bacteria | 8645 |
| 95 | Ga0466711_451068 | 3300042615 | Bacteria | 23955 |
| 96 | Ga0466715_268166 | 3300042616 | Bacteria | 4214 |
| 97 | Ga0466723_052242 | 3300042618 | Bacteria | 24414 |
| 98 | Ga0466723_214049 | 3300042618 | Bacteria | 5842 |
| 99 | Ga0466726_240160 | 3300042619 | Bacteria | 5980 |
| 100 | Ga0466726_420783 | 3300042619 | Bacteria | 10714 |
| 101 | Ga0466692_151397 | 3300042591 | Bacteria | 15083 |
| 102 | Ga0466691_001029 | 3300042593 | Bacteria | 7178 |
| 103 | Ga0466691_139147 | 3300042593 | Bacteria | 13177 |
| 104 | Ga0466696_401295 | 3300042596 | Bacteria | 1287 |
| 105 | Ga0466699_223985 | 3300042597 | Bacteria | 2075 |
| 106 | Ga0466735_037103 | 3300042624 | Bacteria | 1843 |
| 107 | Ga0466735_225379 | 3300042624 | Bacteria | 1516 |
| 108 | Ga0466702_234542 | 3300042635 | Bacteria | 2966 |
| 109 | Ga0466709_318790 | 3300042648 | Bacteria | 29597 |
| 110 | Ga0466708_164022 | 3300042652 | Bacteria | 7599 |
| 111 | Ga0466708_313471 | 3300042652 | Bacteria | 2967 |
| 112 | Ga0466727_335840 | 3300042655 | Bacteria | 1594 |
| 113 | Ga0466700_115399 | 3300042600 | Bacteria | 1689 |
| 114 | Ga0466707_279007 | 3300042601 | Bacteria | 3370 |
| 115 | Ga0466719_456655 | 3300042606 | Bacteria | 6143 |
| 116 | Ga0466721_262941 | 3300042608 | Bacteria | 2328 |
| 117 | Ga0466721_286093 | 3300042608 | Bacteria | 7737 |
| 118 | Ga0466698_473924 | 3300042610 | Bacteria | 1857 |
| 119 | Ga0466705_293950 | 3300042612 | Bacteria | 3078 |
| 120 | Ga0072940_1160059 | 3300005200 | Bacteria | 2777 |
| 121 | Ga0466723_049330 | 3300042618 | Bacteria | 29056 |
| 122 | Ga0466723_128030 | 3300042618 | Bacteria | 26554 |
| 123 | Ga0466723_280555 | 3300042618 | Bacteria | 24215 |
| 124 | Ga0466726_100664 | 3300042619 | Bacteria | 7024 |
| 125 | Ga0466726_487419 | 3300042619 | Bacteria | 1160 |
| 126 | Ga0415639_120637 | 3300038395 | Bacteria | 1987 |
| 127 | Ga0466692_009099 | 3300042591 | Bacteria | 1228 |
| 128 | Ga0466691_119382 | 3300042593 | Bacteria | 6859 |
| 129 | Ga0466691_138710 | 3300042593 | Bacteria | 1293 |
| 130 | Ga0466691_140235 | 3300042593 | Bacteria | 7355 |
| 131 | Ga0466694_221953 | 3300042594 | Unclassified | 1898 |
| 132 | Ga0466696_491409 | 3300042596 | Bacteria | 8739 |
| 133 | Ga0466709_045439 | 3300042648 | Bacteria | 1179 |
| 134 | Ga0466709_126954 | 3300042648 | Bacteria | 6950 |
| 135 | Ga0466709_231423 | 3300042648 | Bacteria | 2462 |
| 136 | Ga0466708_163304 | 3300042652 | Bacteria | 33834 |
| 137 | Ga0466700_309319 | 3300042600 | Bacteria | 1398 |
| 138 | Ga0466707_062687 | 3300042601 | Bacteria | 1925 |
| 139 | Ga0466707_373985 | 3300042601 | Bacteria | 1382 |
| 140 | Ga0466719_152423 | 3300042606 | Bacteria | 16922 |
| 141 | Ga0466722_116622 | 3300042609 | Bacteria | 2849 |
| 142 | Ga0466705_314108 | 3300042612 | Bacteria | 1964 |
| 143 | JGI24695J34938_10007056 | 3300002450 | Bacteria | 6645 |
| 144 | JGI24700J35501_10930683 | 3300002508 | Bacteria | 18596 |
| 145 | Ga0123356_10334585 | 3300010049 | Bacteria | 1632 |
| 146 | Ga0466711_028295 | 3300042615 | Bacteria | 39168 |
| 147 | Ga0466726_090980 | 3300042619 | Bacteria | 4816 |
| 148 | Ga0466726_224456 | 3300042619 | Bacteria | 23696 |
| 149 | Ga0466726_233139 | 3300042619 | Bacteria | 3427 |
| 150 | Ga0466728_008634 | 3300042620 | Bacteria | 3063 |
| 151 | Ga0466690_003732 | 3300042590 | Bacteria | 11343 |
| 152 | Ga0466690_336606 | 3300042590 | Bacteria | 2893 |
| 153 | Ga0466699_289993 | 3300042597 | Bacteria | 1022 |
| 154 | Ga0466703_382792 | 3300042636 | Unclassified | 2618 |
| 155 | Ga0466704_545342 | 3300042643 | Bacteria | 14429 |
| 156 | Ga0466709_103928 | 3300042648 | Bacteria | 6052 |
| 157 | Ga0466708_312416 | 3300042652 | Bacteria | 85118 |
| 158 | Ga0466708_374433 | 3300042652 | Bacteria | 4323 |
| 159 | Ga0466727_206711 | 3300042655 | Unclassified | 1446 |
| 160 | Ga0466727_286507 | 3300042655 | Bacteria | 1301 |
| 161 | Ga0466706_065073 | 3300042599 | Bacteria | 1707 |
| 162 | Ga0466716_015948 | 3300042605 | Bacteria | 8574 |
| 163 | Ga0466719_068554 | 3300042606 | Bacteria | 4780 |
| 164 | Ga0466719_515097 | 3300042606 | Bacteria | 54868 |
| 165 | Ga0466698_329886 | 3300042610 | Bacteria | 1399 |
| 166 | AustNasuHG_c1001729 | 3300000089 | Bacteria | 7891 |
| 167 | JGI24698J34947_10011530 | 3300002449 | Bacteria | 4853 |
| 168 | JGI24695J34938_10000164 | 3300002450 | Bacteria | 61824 |
| 169 | JGI24695J34938_10030486 | 3300002450 | Bacteria | 2511 |
| 170 | Ga0072940_1007803 | 3300005200 | Bacteria | 8489 |
| 171 | Ga0072941_1001351 | 3300005201 | Bacteria | 33692 |
| 172 | Ga0072941_1005007 | 3300005201 | Bacteria | 26558 |
| 173 | Ga0123357_10360465 | 3300009784 | Bacteria | 1377 |
| 174 | Ga0123356_10938857 | 3300010049 | Bacteria | 1036 |
| 175 | Ga0123353_10148118 | 3300010167 | Bacteria | 3751 |
| 176 | Ga0466711_030216 | 3300042615 | Bacteria | 14469 |
| 177 | Ga0466711_065020 | 3300042615 | Bacteria | 13792 |
| 178 | Ga0466715_116296 | 3300042616 | Bacteria | 10085 |
| 179 | Ga0466715_553008 | 3300042616 | Bacteria | 12913 |
| 180 | Ga0466723_216953 | 3300042618 | Bacteria | 1705 |
| 181 | Ga0466726_289339 | 3300042619 | Bacteria | 2244 |
| 182 | Ga0466692_004629 | 3300042591 | Bacteria | 8518 |
| 183 | Ga0466693_109550 | 3300042592 | Bacteria | 1334 |
| 184 | Ga0466693_378756 | 3300042592 | Bacteria | 10021 |
| 185 | Ga0466691_063105 | 3300042593 | Bacteria | 1365 |
| 186 | Ga0466696_066795 | 3300042596 | Bacteria | 20973 |
| 187 | Ga0466696_089626 | 3300042596 | Bacteria | 2456 |
| 188 | Ga0466735_070772 | 3300042624 | Bacteria | 1948 |
| 189 | Ga0466709_325796 | 3300042648 | Bacteria | 1329 |
| 190 | Ga0466707_249903 | 3300042601 | Bacteria | 1479 |
| 191 | Ga0466722_112039 | 3300042609 | Bacteria | 10750 |
| 192 | Ga0466722_175375 | 3300042609 | Bacteria | 10179 |
| 193 | Ga0466705_151123 | 3300042612 | Bacteria | 3900 |
| 194 | AustNasuHG_c1022534 | 3300000089 | Bacteria | 2022 |
| 195 | JGI24695J34938_10015994 | 3300002450 | Bacteria | 3831 |
| 196 | Ga0072941_1005582 | 3300005201 | Bacteria | 22250 |
| 197 | Ga0072941_1048729 | 3300005201 | Bacteria | 10454 |
| 198 | Ga0123357_10215060 | 3300009784 | Bacteria | 2148 |
| 199 | Ga0123356_10431283 | 3300010049 | Bacteria | 1462 |
| 200 | Ga0466711_040360 | 3300042615 | Bacteria | 9484 |
| 201 | Ga0466711_225682 | 3300042615 | Bacteria | 21378 |
| 202 | Ga0466711_477265 | 3300042615 | Bacteria | 3074 |
| 203 | Ga0466715_243487 | 3300042616 | Unclassified | 4145 |
| 204 | Ga0466728_049539 | 3300042620 | Unclassified | 7517 |
| 205 | Ga0466728_270746 | 3300042620 | Bacteria | 1082 |
| 206 | Ga0466692_011156 | 3300042591 | Bacteria | 5995 |
| 207 | Ga0466694_088426 | 3300042594 | Bacteria | 1950 |
| 208 | Ga0466699_062745 | 3300042597 | Bacteria | 14044 |
| 209 | Ga0466699_154541 | 3300042597 | Bacteria | 1886 |
| 210 | Ga0466699_434027 | 3300042597 | Bacteria | 1322 |
| 211 | Ga0466703_257371 | 3300042636 | Bacteria | 18409 |
| 212 | Ga0466704_268625 | 3300042643 | Bacteria | 59494 |
| 213 | Ga0466708_292019 | 3300042652 | Bacteria | 1938 |
| 214 | Ga0466706_114371 | 3300042599 | Bacteria | 1685 |
| 215 | Ga0466700_205482 | 3300042600 | Bacteria | 4941 |
| 216 | Ga0466719_056146 | 3300042606 | Bacteria | 5210 |
| 217 | Ga0466719_136681 | 3300042606 | Bacteria | 2448 |
| 218 | Ga0466719_449668 | 3300042606 | Unclassified | 1779 |
| 219 | Ga0466722_032616 | 3300042609 | Bacteria | 5014 |
| 220 | Ga0466722_155985 | 3300042609 | Bacteria | 1583 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.