Protein Family IF04590

Metagenome Isolate
168 Members
51 Samples
153 Scaffolds
258.02 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_427089|Ga0466690_427089_65_853
Length
239 aa
Sequence
MTRILSFNVNGIRAIEKKGFLDWLAADAPDMLCVQETKAEPGQLSKELKSPHDGDGNRYHTYWASAKKKGYSGVALFSKTEPRSVSQMGIAAFDHEGRVLIAEYEQFTLITAYFPNSQDERRRLAYKLDFCAAIHKPIDLAHPEANEDNAGYYPEERAFMDRFLASGFVDTFRHFSPDQKEAYTWWTYRGGARDRNVGWRLDYHCVDAGFVPFIEDSIIRAGVMGSDHCPVELRIRDTQ

πŸ“Š Sample Types

Isolate 8.9%
Metagenome 91.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 46.9%
Unclassified 30.6%
Kalotermitidae 16.3%
Rhinotermitidae 4.1%
Termopsidae 2.0%

🌳 Taxonomy

Archaea 1
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 18

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
6 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
7 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
10 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
13 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
14 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
15 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
19 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
20 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
21 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
26 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
27 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
30 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
31 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
32 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
33 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
34 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
35 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
36 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
37 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
38 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
39 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
40 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
41 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
42 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
43 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
44 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
45 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
46 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
47 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
48 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_009906 3300042612 Bacteria 1544
2 Ga0466732_000981 3300042656 Bacteria 2916
3 Ga0123356_10067457 3300010049 Bacteria 3351
4 Ga0466712_055256 3300042614 Bacteria 1845
5 Ga0466712_081141 3300042614 Bacteria 3499
6 Ga0466712_155109 3300042614 Bacteria 9189
7 Ga0466712_256394 3300042614 Bacteria 6029
8 Ga0466712_303422 3300042614 Bacteria 26264
9 Ga0466718_058179 3300042617 Bacteria 3613
10 Ga0466718_058608 3300042617 Bacteria 6247
11 Ga0466718_060283 3300042617 Bacteria 1618
12 Ga0466718_098765 3300042617 Bacteria 2309
13 Ga0466723_034759 3300042618 Bacteria 3499
14 Ga0466723_130141 3300042618 Bacteria 92926
15 Ga0264413_106988 3300024493 Unclassified 7559
16 Ga0466720_095750 3300042607 Bacteria 2440
17 Ga0466720_231517 3300042607 Bacteria 12237
18 JGI24698J34947_10021530 3300002449 Bacteria 3466
19 Ga0466702_239754 3300042635 Bacteria 3230
20 Ga0123356_10017511 3300010049 Bacteria 6816
21 Ga0466712_041448 3300042614 Bacteria 21977
22 Ga0466712_161202 3300042614 Bacteria 12165
23 Ga0466718_032744 3300042617 Bacteria 4149
24 Ga0466718_131846 3300042617 Bacteria 4297
25 Ga0466726_058371 3300042619 Bacteria 5691
26 Ga0264413_100122 3300024493 Bacteria 35376
27 Ga0466690_365803 3300042590 Bacteria 1804
28 Ga0466693_102995 3300042592 Bacteria 28234
29 Ga0466691_026858 3300042593 Bacteria 11695
30 Ga0466694_002435 3300042594 Bacteria 4317
31 Ga0466700_343452 3300042600 Bacteria 2114
32 Ga0466717_312477 3300042604 Bacteria 4479
33 AustNasuHG_c1008999 3300000089 Bacteria 3524
34 JGI24698J34947_10033342 3300002449 Bacteria 2703
35 JGI24695J34938_10000096 3300002450 Bacteria 77675
36 JGI24695J34938_10026480 3300002450 Bacteria 2755
37 Ga0072941_1004352 3300005201 Unclassified 6430
38 Ga0072941_1023767 3300005201 Bacteria 4134
39 Ga0072941_1036156 3300005201 Archaea 5975
40 Ga0072941_1063043 3300005201 Bacteria 7538
41 Ga0072941_1255023 3300005201 Bacteria 983
42 Ga0466702_002413 3300042635 Bacteria 1064
43 Ga0466702_231024 3300042635 Bacteria 9050
44 Ga0466732_109188 3300042656 Bacteria 6229
45 Ga0466718_067357 3300042617 Bacteria 7791
46 Ga0466718_075443 3300042617 Bacteria 17626
47 Ga0466694_268928 3300042594 Bacteria 8059
48 Ga0466694_296639 3300042594 Unclassified 6605
49 Ga0466720_225493 3300042607 Bacteria 4098
50 Ga0466698_208249 3300042610 Unclassified 1724
51 JGI24698J34947_10016370 3300002449 Bacteria 4024
52 JGI24698J34947_10058214 3300002449 Bacteria 1914
53 JGI24695J34938_10004199 3300002450 Bacteria 9579
54 JGI24695J34938_10056045 3300002450 Unclassified 1701
55 Ga0072941_1001012 3300005201 Unclassified 13922
56 Ga0072941_1013955 3300005201 Bacteria 8374
57 Ga0466702_060440 3300042635 Bacteria 1254
58 Ga0466704_373072 3300042643 Bacteria 8189
59 Ga0466709_148056 3300042648 Bacteria 27802
60 Ga0466732_076133 3300042656 Bacteria 15677
61 Ga0123356_10000123 3300010049 Bacteria 85175
62 Ga0123353_10038362 3300010167 Bacteria 7528
63 Ga0466712_020114 3300042614 Bacteria 1366
64 Ga0466712_207563 3300042614 Bacteria 94540
65 Ga0466726_084736 3300042619 Bacteria 2756
66 Ga0264413_100244 3300024493 Bacteria 2504
67 Ga0264413_105582 3300024493 Bacteria 13493
68 Ga0466694_163414 3300042594 Bacteria 1461
69 Ga0466699_279764 3300042597 Bacteria 1812
70 Ga0466720_127156 3300042607 Bacteria 1116
71 Ga0466722_094945 3300042609 Bacteria 6189
72 AustNasuHG_c1002442 3300000089 Bacteria 6719
73 JGI24695J34938_10000085 3300002450 Bacteria 80617
74 JGI24695J34938_10018283 3300002450 Bacteria 3509
75 Ga0072941_1001806 3300005201 Bacteria 15220
76 Ga0072941_1004304 3300005201 Bacteria 9064
77 Ga0072941_1020719 3300005201 Bacteria 11529
78 Ga0466731_140119 3300042622 Bacteria 3847
79 Ga0466704_174095 3300042643 Bacteria 32611
80 Ga0466732_070402 3300042656 Bacteria 11171
81 Ga0466732_154082 3300042656 Bacteria 1167
82 Ga0123356_10269470 3300010049 Bacteria 1792
83 Ga0123353_10295872 3300010167 Bacteria 2475
84 Ga0466712_076743 3300042614 Bacteria 9313
85 Ga0466712_087003 3300042614 Unclassified 2158
86 Ga0466715_174601 3300042616 Bacteria 6375
87 Ga0466718_024184 3300042617 Bacteria 23599
88 Ga0264413_108376 3300024493 Bacteria 10668
89 Ga0264413_126252 3300024493 Bacteria 1971
90 Ga0466694_379709 3300042594 Bacteria 72022
91 Ga0466695_333910 3300042595 Bacteria 11762
92 Ga0466699_422529 3300042597 Unclassified 1477
93 Ga0466720_181002 3300042607 Bacteria 45355
94 JGI24695J34938_10009619 3300002450 Bacteria 5362
95 JGI24702J35022_10245521 3300002462 Bacteria 1040
96 Ga0072941_1004355 3300005201 Bacteria 7844
97 Ga0072941_1008435 3300005201 Bacteria 12003
98 Ga0074263_102383 3300005485 Bacteria 2362
99 Ga0466702_092852 3300042635 Bacteria 13928
100 Ga0466702_154987 3300042635 Bacteria 1135
101 Ga0466704_143008 3300042643 Bacteria 1362
102 Ga0466712_171365 3300042614 Bacteria 2122
103 Ga0466712_297957 3300042614 Bacteria 27640
104 Ga0466723_068508 3300042618 Bacteria 1515
105 Ga0466728_478907 3300042620 Bacteria 9355
106 Ga0466690_355589 3300042590 Bacteria 1386
107 Ga0466690_427089 3300042590 Bacteria 1187
108 Ga0466694_139950 3300042594 Bacteria 1499
109 Ga0466694_239789 3300042594 Bacteria 30860
110 Ga0466699_315127 3300042597 Unclassified 1458
111 Ga0466720_030290 3300042607 Unclassified 12839
112 Ga0466720_032077 3300042607 Bacteria 7506
113 AustNasuHG_c1000157 3300000089 Bacteria 21612
114 AustNasuHG_c1002575 3300000089 Bacteria 6547
115 JGI24698J34947_10000069 3300002449 Bacteria 32733
116 JGI24698J34947_10001748 3300002449 Bacteria 11579
117 JGI24698J34947_10041922 3300002449 Unclassified 2354
118 JGI24695J34938_10000951 3300002450 Bacteria 26419
119 Ga0072941_1016584 3300005201 Bacteria 7209
120 Ga0072941_1052890 3300005201 Bacteria 1659
121 Ga0123357_10004358 3300009784 Bacteria 16590
122 Ga0123356_10000396 3300010049 Bacteria 49792
123 Ga0123353_10623832 3300010167 Bacteria 1534
124 Ga0466718_023909 3300042617 Bacteria 4788
125 Ga0264413_100245 3300024493 Bacteria 19068
126 Ga0466692_029489 3300042591 Bacteria 35563
127 Ga0466691_041090 3300042593 Bacteria 3726
128 Ga0466699_120854 3300042597 Bacteria 2737
129 Ga0466699_379387 3300042597 Unclassified 2048
130 Ga0466720_092476 3300042607 Unclassified 1585
131 JGI24698J34947_10083870 3300002449 Bacteria 1485
132 JGI24695J34938_10018520 3300002450 Bacteria 3476
133 JGI24695J34938_10036769 3300002450 Bacteria 2230
134 Ga0072940_1092891 3300005200 Bacteria 2525
135 Ga0466731_103418 3300042622 Bacteria 1156
136 Ga0466702_173562 3300042635 Unclassified 1797
137 Ga0466702_390788 3300042635 Unclassified 7667
138 Ga0466704_359321 3300042643 Bacteria 1086
139 Ga0466709_137016 3300042648 Unclassified 1193
140 Ga0123356_10013818 3300010049 Unclassified 7776
141 Ga0123353_10106671 3300010167 Bacteria 4513
142 Ga0466718_005195 3300042617 Unclassified 8785
143 Ga0466723_092564 3300042618 Bacteria 4098
144 Ga0415639_159477 3300038395 Bacteria 1720
145 Ga0466690_042416 3300042590 Bacteria 3334
146 Ga0466690_298666 3300042590 Bacteria 1243
147 Ga0466694_131584 3300042594 Bacteria 8532
148 Ga0466694_280106 3300042594 Bacteria 3054
149 Ga0466720_117570 3300042607 Bacteria 11786
150 AustNasuHG_c1007646 3300000089 Bacteria 3833
151 JGI24695J34938_10022228 3300002450 Bacteria 3084
152 Ga0072940_1011733 3300005200 Bacteria 22116
153 Ga0072941_1004305 3300005201 Bacteria 18196

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 170 228 0.79

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03372 GO:0003824 catalytic activity MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.