Protein Family IF04590
Metagenome
Isolate
168
Members
51
Samples
153
Scaffolds
258.02
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_427089|Ga0466690_427089_65_853
- Length
- 239 aa
- Sequence
- MTRILSFNVNGIRAIEKKGFLDWLAADAPDMLCVQETKAEPGQLSKELKSPHDGDGNRYHTYWASAKKKGYSGVALFSKTEPRSVSQMGIAAFDHEGRVLIAEYEQFTLITAYFPNSQDERRRLAYKLDFCAAIHKPIDLAHPEANEDNAGYYPEERAFMDRFLASGFVDTFRHFSPDQKEAYTWWTYRGGARDRNVGWRLDYHCVDAGFVPFIEDSIIRAGVMGSDHCPVELRIRDTQ
Sample Types
Isolate
8.9%
Metagenome
91.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.9%
Unclassified
30.6%
Kalotermitidae
16.3%
Rhinotermitidae
4.1%
Termopsidae
2.0%
Taxonomy
Archaea
1
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 19 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 30 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 38 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 39 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 40 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 41 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 42 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 43 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 46 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 47 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 48 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_009906 | 3300042612 | Bacteria | 1544 |
| 2 | Ga0466732_000981 | 3300042656 | Bacteria | 2916 |
| 3 | Ga0123356_10067457 | 3300010049 | Bacteria | 3351 |
| 4 | Ga0466712_055256 | 3300042614 | Bacteria | 1845 |
| 5 | Ga0466712_081141 | 3300042614 | Bacteria | 3499 |
| 6 | Ga0466712_155109 | 3300042614 | Bacteria | 9189 |
| 7 | Ga0466712_256394 | 3300042614 | Bacteria | 6029 |
| 8 | Ga0466712_303422 | 3300042614 | Bacteria | 26264 |
| 9 | Ga0466718_058179 | 3300042617 | Bacteria | 3613 |
| 10 | Ga0466718_058608 | 3300042617 | Bacteria | 6247 |
| 11 | Ga0466718_060283 | 3300042617 | Bacteria | 1618 |
| 12 | Ga0466718_098765 | 3300042617 | Bacteria | 2309 |
| 13 | Ga0466723_034759 | 3300042618 | Bacteria | 3499 |
| 14 | Ga0466723_130141 | 3300042618 | Bacteria | 92926 |
| 15 | Ga0264413_106988 | 3300024493 | Unclassified | 7559 |
| 16 | Ga0466720_095750 | 3300042607 | Bacteria | 2440 |
| 17 | Ga0466720_231517 | 3300042607 | Bacteria | 12237 |
| 18 | JGI24698J34947_10021530 | 3300002449 | Bacteria | 3466 |
| 19 | Ga0466702_239754 | 3300042635 | Bacteria | 3230 |
| 20 | Ga0123356_10017511 | 3300010049 | Bacteria | 6816 |
| 21 | Ga0466712_041448 | 3300042614 | Bacteria | 21977 |
| 22 | Ga0466712_161202 | 3300042614 | Bacteria | 12165 |
| 23 | Ga0466718_032744 | 3300042617 | Bacteria | 4149 |
| 24 | Ga0466718_131846 | 3300042617 | Bacteria | 4297 |
| 25 | Ga0466726_058371 | 3300042619 | Bacteria | 5691 |
| 26 | Ga0264413_100122 | 3300024493 | Bacteria | 35376 |
| 27 | Ga0466690_365803 | 3300042590 | Bacteria | 1804 |
| 28 | Ga0466693_102995 | 3300042592 | Bacteria | 28234 |
| 29 | Ga0466691_026858 | 3300042593 | Bacteria | 11695 |
| 30 | Ga0466694_002435 | 3300042594 | Bacteria | 4317 |
| 31 | Ga0466700_343452 | 3300042600 | Bacteria | 2114 |
| 32 | Ga0466717_312477 | 3300042604 | Bacteria | 4479 |
| 33 | AustNasuHG_c1008999 | 3300000089 | Bacteria | 3524 |
| 34 | JGI24698J34947_10033342 | 3300002449 | Bacteria | 2703 |
| 35 | JGI24695J34938_10000096 | 3300002450 | Bacteria | 77675 |
| 36 | JGI24695J34938_10026480 | 3300002450 | Bacteria | 2755 |
| 37 | Ga0072941_1004352 | 3300005201 | Unclassified | 6430 |
| 38 | Ga0072941_1023767 | 3300005201 | Bacteria | 4134 |
| 39 | Ga0072941_1036156 | 3300005201 | Archaea | 5975 |
| 40 | Ga0072941_1063043 | 3300005201 | Bacteria | 7538 |
| 41 | Ga0072941_1255023 | 3300005201 | Bacteria | 983 |
| 42 | Ga0466702_002413 | 3300042635 | Bacteria | 1064 |
| 43 | Ga0466702_231024 | 3300042635 | Bacteria | 9050 |
| 44 | Ga0466732_109188 | 3300042656 | Bacteria | 6229 |
| 45 | Ga0466718_067357 | 3300042617 | Bacteria | 7791 |
| 46 | Ga0466718_075443 | 3300042617 | Bacteria | 17626 |
| 47 | Ga0466694_268928 | 3300042594 | Bacteria | 8059 |
| 48 | Ga0466694_296639 | 3300042594 | Unclassified | 6605 |
| 49 | Ga0466720_225493 | 3300042607 | Bacteria | 4098 |
| 50 | Ga0466698_208249 | 3300042610 | Unclassified | 1724 |
| 51 | JGI24698J34947_10016370 | 3300002449 | Bacteria | 4024 |
| 52 | JGI24698J34947_10058214 | 3300002449 | Bacteria | 1914 |
| 53 | JGI24695J34938_10004199 | 3300002450 | Bacteria | 9579 |
| 54 | JGI24695J34938_10056045 | 3300002450 | Unclassified | 1701 |
| 55 | Ga0072941_1001012 | 3300005201 | Unclassified | 13922 |
| 56 | Ga0072941_1013955 | 3300005201 | Bacteria | 8374 |
| 57 | Ga0466702_060440 | 3300042635 | Bacteria | 1254 |
| 58 | Ga0466704_373072 | 3300042643 | Bacteria | 8189 |
| 59 | Ga0466709_148056 | 3300042648 | Bacteria | 27802 |
| 60 | Ga0466732_076133 | 3300042656 | Bacteria | 15677 |
| 61 | Ga0123356_10000123 | 3300010049 | Bacteria | 85175 |
| 62 | Ga0123353_10038362 | 3300010167 | Bacteria | 7528 |
| 63 | Ga0466712_020114 | 3300042614 | Bacteria | 1366 |
| 64 | Ga0466712_207563 | 3300042614 | Bacteria | 94540 |
| 65 | Ga0466726_084736 | 3300042619 | Bacteria | 2756 |
| 66 | Ga0264413_100244 | 3300024493 | Bacteria | 2504 |
| 67 | Ga0264413_105582 | 3300024493 | Bacteria | 13493 |
| 68 | Ga0466694_163414 | 3300042594 | Bacteria | 1461 |
| 69 | Ga0466699_279764 | 3300042597 | Bacteria | 1812 |
| 70 | Ga0466720_127156 | 3300042607 | Bacteria | 1116 |
| 71 | Ga0466722_094945 | 3300042609 | Bacteria | 6189 |
| 72 | AustNasuHG_c1002442 | 3300000089 | Bacteria | 6719 |
| 73 | JGI24695J34938_10000085 | 3300002450 | Bacteria | 80617 |
| 74 | JGI24695J34938_10018283 | 3300002450 | Bacteria | 3509 |
| 75 | Ga0072941_1001806 | 3300005201 | Bacteria | 15220 |
| 76 | Ga0072941_1004304 | 3300005201 | Bacteria | 9064 |
| 77 | Ga0072941_1020719 | 3300005201 | Bacteria | 11529 |
| 78 | Ga0466731_140119 | 3300042622 | Bacteria | 3847 |
| 79 | Ga0466704_174095 | 3300042643 | Bacteria | 32611 |
| 80 | Ga0466732_070402 | 3300042656 | Bacteria | 11171 |
| 81 | Ga0466732_154082 | 3300042656 | Bacteria | 1167 |
| 82 | Ga0123356_10269470 | 3300010049 | Bacteria | 1792 |
| 83 | Ga0123353_10295872 | 3300010167 | Bacteria | 2475 |
| 84 | Ga0466712_076743 | 3300042614 | Bacteria | 9313 |
| 85 | Ga0466712_087003 | 3300042614 | Unclassified | 2158 |
| 86 | Ga0466715_174601 | 3300042616 | Bacteria | 6375 |
| 87 | Ga0466718_024184 | 3300042617 | Bacteria | 23599 |
| 88 | Ga0264413_108376 | 3300024493 | Bacteria | 10668 |
| 89 | Ga0264413_126252 | 3300024493 | Bacteria | 1971 |
| 90 | Ga0466694_379709 | 3300042594 | Bacteria | 72022 |
| 91 | Ga0466695_333910 | 3300042595 | Bacteria | 11762 |
| 92 | Ga0466699_422529 | 3300042597 | Unclassified | 1477 |
| 93 | Ga0466720_181002 | 3300042607 | Bacteria | 45355 |
| 94 | JGI24695J34938_10009619 | 3300002450 | Bacteria | 5362 |
| 95 | JGI24702J35022_10245521 | 3300002462 | Bacteria | 1040 |
| 96 | Ga0072941_1004355 | 3300005201 | Bacteria | 7844 |
| 97 | Ga0072941_1008435 | 3300005201 | Bacteria | 12003 |
| 98 | Ga0074263_102383 | 3300005485 | Bacteria | 2362 |
| 99 | Ga0466702_092852 | 3300042635 | Bacteria | 13928 |
| 100 | Ga0466702_154987 | 3300042635 | Bacteria | 1135 |
| 101 | Ga0466704_143008 | 3300042643 | Bacteria | 1362 |
| 102 | Ga0466712_171365 | 3300042614 | Bacteria | 2122 |
| 103 | Ga0466712_297957 | 3300042614 | Bacteria | 27640 |
| 104 | Ga0466723_068508 | 3300042618 | Bacteria | 1515 |
| 105 | Ga0466728_478907 | 3300042620 | Bacteria | 9355 |
| 106 | Ga0466690_355589 | 3300042590 | Bacteria | 1386 |
| 107 | Ga0466690_427089 | 3300042590 | Bacteria | 1187 |
| 108 | Ga0466694_139950 | 3300042594 | Bacteria | 1499 |
| 109 | Ga0466694_239789 | 3300042594 | Bacteria | 30860 |
| 110 | Ga0466699_315127 | 3300042597 | Unclassified | 1458 |
| 111 | Ga0466720_030290 | 3300042607 | Unclassified | 12839 |
| 112 | Ga0466720_032077 | 3300042607 | Bacteria | 7506 |
| 113 | AustNasuHG_c1000157 | 3300000089 | Bacteria | 21612 |
| 114 | AustNasuHG_c1002575 | 3300000089 | Bacteria | 6547 |
| 115 | JGI24698J34947_10000069 | 3300002449 | Bacteria | 32733 |
| 116 | JGI24698J34947_10001748 | 3300002449 | Bacteria | 11579 |
| 117 | JGI24698J34947_10041922 | 3300002449 | Unclassified | 2354 |
| 118 | JGI24695J34938_10000951 | 3300002450 | Bacteria | 26419 |
| 119 | Ga0072941_1016584 | 3300005201 | Bacteria | 7209 |
| 120 | Ga0072941_1052890 | 3300005201 | Bacteria | 1659 |
| 121 | Ga0123357_10004358 | 3300009784 | Bacteria | 16590 |
| 122 | Ga0123356_10000396 | 3300010049 | Bacteria | 49792 |
| 123 | Ga0123353_10623832 | 3300010167 | Bacteria | 1534 |
| 124 | Ga0466718_023909 | 3300042617 | Bacteria | 4788 |
| 125 | Ga0264413_100245 | 3300024493 | Bacteria | 19068 |
| 126 | Ga0466692_029489 | 3300042591 | Bacteria | 35563 |
| 127 | Ga0466691_041090 | 3300042593 | Bacteria | 3726 |
| 128 | Ga0466699_120854 | 3300042597 | Bacteria | 2737 |
| 129 | Ga0466699_379387 | 3300042597 | Unclassified | 2048 |
| 130 | Ga0466720_092476 | 3300042607 | Unclassified | 1585 |
| 131 | JGI24698J34947_10083870 | 3300002449 | Bacteria | 1485 |
| 132 | JGI24695J34938_10018520 | 3300002450 | Bacteria | 3476 |
| 133 | JGI24695J34938_10036769 | 3300002450 | Bacteria | 2230 |
| 134 | Ga0072940_1092891 | 3300005200 | Bacteria | 2525 |
| 135 | Ga0466731_103418 | 3300042622 | Bacteria | 1156 |
| 136 | Ga0466702_173562 | 3300042635 | Unclassified | 1797 |
| 137 | Ga0466702_390788 | 3300042635 | Unclassified | 7667 |
| 138 | Ga0466704_359321 | 3300042643 | Bacteria | 1086 |
| 139 | Ga0466709_137016 | 3300042648 | Unclassified | 1193 |
| 140 | Ga0123356_10013818 | 3300010049 | Unclassified | 7776 |
| 141 | Ga0123353_10106671 | 3300010167 | Bacteria | 4513 |
| 142 | Ga0466718_005195 | 3300042617 | Unclassified | 8785 |
| 143 | Ga0466723_092564 | 3300042618 | Bacteria | 4098 |
| 144 | Ga0415639_159477 | 3300038395 | Bacteria | 1720 |
| 145 | Ga0466690_042416 | 3300042590 | Bacteria | 3334 |
| 146 | Ga0466690_298666 | 3300042590 | Bacteria | 1243 |
| 147 | Ga0466694_131584 | 3300042594 | Bacteria | 8532 |
| 148 | Ga0466694_280106 | 3300042594 | Bacteria | 3054 |
| 149 | Ga0466720_117570 | 3300042607 | Bacteria | 11786 |
| 150 | AustNasuHG_c1007646 | 3300000089 | Bacteria | 3833 |
| 151 | JGI24695J34938_10022228 | 3300002450 | Bacteria | 3084 |
| 152 | Ga0072940_1011733 | 3300005200 | Bacteria | 22116 |
| 153 | Ga0072941_1004305 | 3300005201 | Bacteria | 18196 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03372 | Exo_endo_phos | Endonuclease/Exonuclease/phosphatase family | 170 | 228 | 0.79 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03372 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.