Protein Family IF04567
Metagenome
102
Members
35
Samples
102
Scaffolds
263.19
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_321918|Ga0466690_321918_628_1620
- Length
- 313 aa
- Sequence
- MTNAFSAAPFFLATDASFLVVYKPPRMHSSPLKRRAADAPVGAPAGRCVSGEQTLLDWCVRSFPEVTAVRGRNPWEGGLLHRLDYETRGLTLIARTQAAFDALLAAGQAGRFVKEYAALAERLFEAGDGLPPGPFMPSAPPVSIESAFRPYGPGRKAVRPVPVILPGGKPGKRALKEIVLDQGQPYRTGIFETKAEGELIGLCVRICRGFRHQLRCHLAWLGYPLVNDALYGGMSRPEYPGLALLAEAIAFPDPLTGAARQFRLDCNHSAACGTPEVVRELVSAFPDRRSEVSMPHGERPGKCRNKEQCRRAD
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.5%
Kalotermitidae
39.4%
Rhinotermitidae
6.1%
Unclassified
3.0%
Termopsidae
3.0%
Taxonomy
Archaea
0
Bacteria
101
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 7 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 8 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 9 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 10 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 11 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466719_108702 | 3300042606 | Bacteria | 5220 |
| 2 | Ga0466719_199085 | 3300042606 | Bacteria | 3041 |
| 3 | Ga0466712_087561 | 3300042614 | Bacteria | 5024 |
| 4 | Ga0466712_259256 | 3300042614 | Bacteria | 9311 |
| 5 | Ga0123353_10811644 | 3300010167 | Bacteria | 1290 |
| 6 | JGI24698J34947_10014301 | 3300002449 | Bacteria | 4321 |
| 7 | JGI24698J34947_10102702 | 3300002449 | Bacteria | 1281 |
| 8 | Ga0072940_1026930 | 3300005200 | Bacteria | 1237 |
| 9 | Ga0466692_105625 | 3300042591 | Bacteria | 30427 |
| 10 | Ga0466694_143588 | 3300042594 | Bacteria | 1389 |
| 11 | Ga0466702_154134 | 3300042635 | Bacteria | 22134 |
| 12 | Ga0466703_074525 | 3300042636 | Bacteria | 7008 |
| 13 | Ga0466703_124691 | 3300042636 | Bacteria | 13494 |
| 14 | Ga0466732_256138 | 3300042656 | Bacteria | 1219 |
| 15 | Ga0466712_035782 | 3300042614 | Bacteria | 14619 |
| 16 | Ga0466712_111246 | 3300042614 | Bacteria | 10635 |
| 17 | Ga0466715_280099 | 3300042616 | Bacteria | 9107 |
| 18 | Ga0466726_249493 | 3300042619 | Bacteria | 3115 |
| 19 | Ga0123357_10163164 | 3300009784 | Bacteria | 2664 |
| 20 | Ga0123355_10253755 | 3300009826 | Bacteria | 2471 |
| 21 | AustNasuHG_c1041846 | 3300000089 | Bacteria | 1098 |
| 22 | JGI24698J34947_10001536 | 3300002449 | Bacteria | 12207 |
| 23 | JGI24698J34947_10004297 | 3300002449 | Bacteria | 7755 |
| 24 | JGI24698J34947_10066399 | 3300002449 | Bacteria | 1755 |
| 25 | Ga0072940_1058799 | 3300005200 | Bacteria | 3277 |
| 26 | Ga0072941_1008298 | 3300005201 | Bacteria | 32166 |
| 27 | Ga0264413_134879 | 3300024493 | Bacteria | 1365 |
| 28 | Ga0466691_202144 | 3300042593 | Bacteria | 37125 |
| 29 | Ga0466694_074190 | 3300042594 | Bacteria | 2697 |
| 30 | Ga0466694_259725 | 3300042594 | Bacteria | 1071 |
| 31 | Ga0466702_197588 | 3300042635 | Bacteria | 25284 |
| 32 | Ga0466703_006413 | 3300042636 | Bacteria | 11246 |
| 33 | Ga0466708_198981 | 3300042652 | Bacteria | 17533 |
| 34 | Ga0466732_213267 | 3300042656 | Bacteria | 2460 |
| 35 | Ga0466716_455815 | 3300042605 | Bacteria | 2772 |
| 36 | Ga0466720_066661 | 3300042607 | Bacteria | 3477 |
| 37 | Ga0466712_131747 | 3300042614 | Bacteria | 24986 |
| 38 | Ga0466696_504803 | 3300042596 | Bacteria | 23151 |
| 39 | Ga0466699_116673 | 3300042597 | Bacteria | 22899 |
| 40 | Ga0466705_305796 | 3300042612 | Bacteria | 3816 |
| 41 | Ga0466704_132515 | 3300042643 | Bacteria | 1835 |
| 42 | Ga0466722_162418 | 3300042609 | Bacteria | 12534 |
| 43 | Ga0466705_407020 | 3300042612 | Bacteria | 6708 |
| 44 | Ga0466712_033445 | 3300042614 | Bacteria | 15060 |
| 45 | Ga0466726_462550 | 3300042619 | Bacteria | 1376 |
| 46 | Ga0466728_030422 | 3300042620 | Bacteria | 3111 |
| 47 | Ga0466728_277960 | 3300042620 | Bacteria | 23290 |
| 48 | AustNasuHG_c1015557 | 3300000089 | Bacteria | 2565 |
| 49 | JGI24698J34947_10000321 | 3300002449 | Bacteria | 21165 |
| 50 | JGI24698J34947_10000649 | 3300002449 | Bacteria | 16828 |
| 51 | JGI24695J34938_10009386 | 3300002450 | Bacteria | 5444 |
| 52 | JGI24695J34938_10012398 | 3300002450 | Bacteria | 4518 |
| 53 | Ga0072940_1026931 | 3300005200 | Bacteria | 974 |
| 54 | Ga0072940_1195431 | 3300005200 | Bacteria | 1322 |
| 55 | Ga0466694_361086 | 3300042594 | Bacteria | 2921 |
| 56 | Ga0466705_344273 | 3300042612 | Bacteria | 9990 |
| 57 | Ga0466704_181234 | 3300042643 | Bacteria | 4491 |
| 58 | Ga0466716_085325 | 3300042605 | Bacteria | 8496 |
| 59 | Ga0466723_004091 | 3300042618 | Bacteria | 5362 |
| 60 | Ga0466723_020817 | 3300042618 | Bacteria | 1560 |
| 61 | Ga0466726_203888 | 3300042619 | Bacteria | 2689 |
| 62 | Ga0123357_10005184 | 3300009784 | Bacteria | 15553 |
| 63 | JGI24698J34947_10000277 | 3300002449 | Bacteria | 22057 |
| 64 | JGI24698J34947_10001209 | 3300002449 | Bacteria | 13513 |
| 65 | Ga0072941_1036997 | 3300005201 | Bacteria | 1530 |
| 66 | Ga0466690_149179 | 3300042590 | Bacteria | 9626 |
| 67 | Ga0466696_106850 | 3300042596 | Bacteria | 9467 |
| 68 | Ga0466705_246027 | 3300042612 | Bacteria | 50897 |
| 69 | Ga0466716_483706 | 3300042605 | Bacteria | 1717 |
| 70 | Ga0466720_045928 | 3300042607 | Bacteria | 5516 |
| 71 | Ga0466712_139404 | 3300042614 | Bacteria | 16149 |
| 72 | Ga0466712_222234 | 3300042614 | Bacteria | 3684 |
| 73 | Ga0466718_146278 | 3300042617 | Bacteria | 1301 |
| 74 | Ga0466718_165899 | 3300042617 | Bacteria | 7261 |
| 75 | Ga0466723_009214 | 3300042618 | Bacteria | 5235 |
| 76 | Ga0123353_10603873 | 3300010167 | Bacteria | 1567 |
| 77 | AustNasuHG_c1001692 | 3300000089 | Bacteria | 7966 |
| 78 | JGI24698J34947_10003934 | 3300002449 | Bacteria | 8077 |
| 79 | Ga0466694_317424 | 3300042594 | Bacteria | 9831 |
| 80 | Ga0466696_181188 | 3300042596 | Bacteria | 26938 |
| 81 | Ga0466719_357452 | 3300042606 | Bacteria | 2992 |
| 82 | Ga0466720_045662 | 3300042607 | Bacteria | 2337 |
| 83 | Ga0466720_047372 | 3300042607 | Bacteria | 1523 |
| 84 | Ga0466722_248895 | 3300042609 | Bacteria | 8091 |
| 85 | Ga0466726_323321 | 3300042619 | Bacteria | 3329 |
| 86 | JGI24702J35022_10022066 | 3300002462 | Bacteria | 3450 |
| 87 | Ga0264413_112757 | 3300024493 | Bacteria | 3007 |
| 88 | Ga0466690_321918 | 3300042590 | Bacteria | 3088 |
| 89 | Ga0466699_220892 | 3300042597 | Bacteria | 2166 |
| 90 | Ga0466709_290540 | 3300042648 | Bacteria | 15902 |
| 91 | Ga0466709_321116 | 3300042648 | Bacteria | 2796 |
| 92 | Ga0466732_361261 | 3300042656 | Bacteria | 1662 |
| 93 | Ga0466707_242335 | 3300042601 | Bacteria | 1230 |
| 94 | Ga0466712_039935 | 3300042614 | Bacteria | 3612 |
| 95 | Ga0466715_382132 | 3300042616 | Bacteria | 4843 |
| 96 | Ga0466723_357883 | 3300042618 | Bacteria | 72636 |
| 97 | Ga0415639_013921 | 3300038395 | Bacteria | 15151 |
| 98 | Ga0466690_095471 | 3300042590 | Bacteria | 57449 |
| 99 | Ga0466705_006772 | 3300042612 | Unclassified | 2684 |
| 100 | Ga0466705_375099 | 3300042612 | Bacteria | 4842 |
| 101 | Ga0466703_082590 | 3300042636 | Bacteria | 51436 |
| 102 | Ga0466703_321048 | 3300042636 | Bacteria | 44056 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00849 | PseudoU_synth_2 | RNA pseudouridylate synthase | 18 | 219 | 0.8 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.